Property Summary

NCBI Gene PubMed Count 7
PubMed Score 14.18
PubTator Score 10.04

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (1)

AA Sequence

MSELLRARSQSSERGNDQESSQPVGSVIVQEPTEEKRQEEEPPTDNQGIAPSGEIENQAVPAFQGPDMEA      1 - 70
FQQELALLKIEDEPGDGPDVREGIMPTFDLTKVLEAGDAQP                                  71 - 111
//

Text Mined References (8)

PMID Year Title