Property Summary

NCBI Gene PubMed Count 36
PubMed Score 48.34
PubTator Score 48.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (22)

PMID Text
26211970 The risk-associated allele of rs2370615 predisposes to allergic disease by increasing PAG1 expression, which might promote B cell activation and have a pro-inflammatory effect.
26062415 Up-regulated expression of CBP in Jurkat cells could reduce cell homogeneity and promote cell apoptosis
25684946 CBP may decrease the metastasis of esophageal carcinoma by inhibiting the activation of Src.
25005592 No association Pag1 mutation with patient with Schizophrenia.
23671581 The inhibitory function of novobiocin in disrupting the HIF1alpha/p300 complex might be important in tumor cell growth.
22994656 siRNA directed against PAG1 in a radioresistant (Hep-2max) cell line dramatically enhanced the radiosensitivity and IR-induced cell death.
22659621 findings support a negative regulatory function for Cbp/PAG in proximal B cell receptor signaling in normal and EBV-transformed B cells
22027792 expression of CBP gene is decreased in esophageal carcinoma, which might contribute to the tumorigenesis and progression.
21388951 Cbp down-regulation is primarily mediated by epigenetic histone modifications via oncogenic MAPK/PI3K pathways in a subset of cancer cells.
21156787 Results indicate that Cbp is required for the Csk-mediated inactivation of c-Src and may control the promotion of malignancy in NSCLC tumors that are characterized by c-Src upregulation.
21092590 An over-expression of PAG1 in PC-3M-1E8 cells effectively suppresses the activation of Ras and ERK, as well as the cyclin D1 expression, leading to an inhibition of the proliferation ability of tumor cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20561033 In the membrane environment of ALK+ lymphoma rafts, where the glycosphingolipid to signaling protein ratio is higher than in B-NHL rafts, the Lyn activity is suboptimal and does not allow the formation of an efficient Lyn-Cbp/PAG signalosome
20388373 PAG1 protein was downregulated in PC-3M-1E8 prostate cancer cell line.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19581936 new insights into the function of Cbp in modulating RhoA activation, by which Cbp might contribute to renal cell carcinogenesis
18070987 role in control of proliferation and survival in most B-non-Hodgkin lymphomas
18056706 engagement of the SH2 domain on PAG renders FynT insensitive to Csk negative regulation
17389760 PAG negatively regulates Ras proteins, and by knocking down PAG there is enhanced Src kinase activity and Ras activation.
16947079 High PAG-binding ability with CSK in vitro as well as the human PAG structure characterized by 11 alpha-helix structures including a 3 kDa transmembrane domain are reported.
16636672 Study shows EGF-stimulation-induced Csk-binding protein (Cbp) tyrosine phosphorylation followed by Cbp-Csk association, in a SFK-dependent manner.

AA Sequence

MGPAGSLLGSGQMQITLWGSLAAVAIFFVITFLIFLCSSCDREKKPRQHSGDHENLMNVPSDKEMFSRSV      1 - 70
TSLATDAPASSEQNGALTNGDILSEDSTLTCMQHYEEVQTSASDLLDSQDSTGKPKCHQSRELPRIPPES     71 - 140
AVDTMLTARSVDGDQGLGMEGPYEVLKDSSSQENMVEDCLYETVKEIKEVAAAAHLEKGHSGKAKSTSAS    141 - 210
KELPGPQTEGKAEFAEYASVDRNKKCRQSVNVESILGNSCDPEEEAPPPVPVKLLDENENLQEKEGGEAE    211 - 280
ESATDTTSETNKRFSSLSYKSREEDPTLTEEEISAMYSSVNKPGQLVNKSGQSLTVPESTYTSIQGDPQR    281 - 350
SPSSCNDLYATVKDFEKTPNSTLPPAGRPSEEPEPDYEAIQTLNREEEKATLGTNGHHGLVPKENDYESI    351 - 420
SDLQQGRDITRL                                                              421 - 432
//

Text Mined References (39)

PMID Year Title
26211970 2015 Long-Range Modulation of PAG1 Expression by 8q21 Allergy Risk Variants.
26062415 2015 [Phenotypic changes and apoptosis of Jurkat cells induced by over-expression of C-Src kinase-binding protein].
25684946 2015 Overexpression of Csk-binding protein decreases growth, invasion, and migration of esophageal carcinoma cells by controlling Src activation.
25005592 2015 Sequencing and expression analyses of the synaptic lipid raft adapter gene PAG1 in schizophrenia.
24163127 2014 Genome-wide association study identifies multiple loci associated with bladder cancer risk.
23866081 2013 Lyn, a Src family kinase, regulates activation of epidermal growth factor receptors in lung adenocarcinoma cells.
23671581 2013 A novel function of novobiocin: disrupting the interaction of HIF 1? and p300/CBP through direct binding to the HIF1? C-terminal activation domain.
23022100 2012 Discovery and fine mapping of serum protein loci through transethnic meta-analysis.
22994656 2012 Identification of the PAG1 gene as a novel target of inherent radioresistance in human laryngeal carcinoma cells.
22659621 2012 Modulation of proximal signaling in normal and transformed B cells by transmembrane adapter Cbp/PAG.
22027792 2011 [Expression of Csk-binding protein in esophageal carcinoma and its possible implications].
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
21388951 2011 Down-regulation of the tumor suppressor C-terminal Src kinase (Csk)-binding protein (Cbp)/PAG1 is mediated by epigenetic histone modifications via the mitogen-activated protein kinase (MAPK)/phosphatidylinositol 3-kinase (PI3K) pathway.
21156787 2011 The transmembrane adaptor Cbp/PAG1 controls the malignant potential of human non-small cell lung cancers that have c-src upregulation.
21092590 2010 [Influence of phosphoprotein associated with glycosphingolipid microdomains 1 on biologic behavior of human prostatic cancer cell line in-vitro].
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20561033 2010 The sphingolipid-rich rafts of ALK+ lymphomas downregulate the Lyn-Cbp/PAG signalosome.
20388373 2010 [Screening of phosphoprotein associated with glycosphingolipid microdomains 1 (PAG1) by cDNA microarray and influence of overexpression of PAG1 on biologic behavior of human metastatic prostatic cancer cell line in vitro].
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19581936 2009 Overexpression of Csk-binding protein contributes to renal cell carcinogenesis.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18070987 2008 Oncogenic association of the Cbp/PAG adaptor protein with the Lyn tyrosine kinase in human B-NHL rafts.
18056706 2008 Regulation of FynT function by dual domain docking on PAG/Cbp.
17911601 2007 Inhibition of T cell activation by cyclic adenosine 5'-monophosphate requires lipid raft targeting of protein kinase A type I by the A-kinase anchoring protein ezrin.
17389760 2007 A novel negative regulatory function of the phosphoprotein associated with glycosphingolipid-enriched microdomains: blocking Ras activation.
17143285 2007 Germline gain-of-function mutations in SOS1 cause Noonan syndrome.
16947079 2006 Expression and purification of human PAG, a transmembrane adapter protein using an insect cell expression system and its structure basis.
16636672 2006 Csk-binding protein (Cbp) negatively regulates epidermal growth factor-induced cell transformation by controlling Src activation.
16160011 2006 Transmembrane adaptor molecules: a new category of lymphoid-cell markers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14665621 2004 Roles of Gab1 and SHP2 in paxillin tyrosine dephosphorylation and Src activation in response to epidermal growth factor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11684085 2001 Interaction between two adapter proteins, PAG and EBP50: a possible link between membrane rafts and actin cytoskeleton.
10790433 2000 Phosphoprotein associated with glycosphingolipid-enriched microdomains (PAG), a novel ubiquitously expressed transmembrane adaptor protein, binds the protein tyrosine kinase csk and is involved in regulation of T cell activation.
9334312 1997 The PAG gene product, a stress-induced protein with antioxidant properties, is an Abl SH3-binding protein and a physiological inhibitor of c-Abl tyrosine kinase activity.