Property Summary

NCBI Gene PubMed Count 20
PubMed Score 4.93
PubTator Score 7.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis 1.100 8.3e-04
group 3 medulloblastoma 2.100 4.2e-05
medulloblastoma, large-cell 1.100 2.8e-04
primitive neuroectodermal tumor 1.500 1.3e-03
tuberculosis 1.100 1.2e-06
non-small cell lung cancer 1.861 9.0e-29
Hydrolethalus syndrome -1.285 6.2e-03
breast carcinoma 1.700 2.7e-06
atypical teratoid/rhabdoid tumor 1.200 5.9e-05
lung adenocarcinoma 1.600 1.1e-08
Breast cancer 1.600 1.5e-22
ductal carcinoma in situ 1.900 1.6e-04
invasive ductal carcinoma 2.600 9.4e-05

Protein-protein Interaction (2)

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
492972 screening 930 / 0 / 334531 Fluorescence polarization-based primary biochemical high throughput screening assay to identify inhibitors of human platelet-activating factor acetylhydrolase 1B, catalytic subunit 3 (PAFAH1B3)
492979 summary 0 / 0 / 0 Summary of the probe development efforts to identify inhibitors of human platelet-activating factor acetylhydrolase 1B, catalytic subunit 3 (PAFAH1B3)
493032 screening 118 / 0 / 274 Fluorescence polarization-based biochemical high throughput confirmation assay for inhibitors of human platelet-activating factor acetylhydrolase 1B, catalytic subunit 3 (PAFAH1B3)

Gene RIF (5)

PMID Text
25945974 PAFAH1B2 and 1B3 are important in maintaining cancer pathogenicity across a wide spectrum of cancer types.
24954006 PAFAH1B3 as a critical metabolic node in breast cancer
22461910 PAFAH1B3 has been found to be differentially methylated in head and neck squamous cell carcinoma.
21844189 intracellular type I PAF acetylhydrolase (PAFAH1B2 and PAFAH1B3) is the major aspirin hydrolase of human blood
19622634 These results indicate an antagonistic effect of alpha1, alpha2 and Ndel1 for Lis1 binding, probably to modulate dynein functions in vivo.

AA Sequence

MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNF      1 - 70
GIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLP     71 - 140
RGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHS    141 - 210
LLLRLLAQDQGQGAPLLEPAP                                                     211 - 231
//

Text Mined References (26)

PMID Year Title
25945974 2015 Activity-Based Protein Profiling of Oncogene-Driven Changes in Metabolism Reveals Broad Dysregulation of PAFAH1B2 and 1B3 in Cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24954006 2014 Metabolic profiling reveals PAFAH1B3 as a critical driver of breast cancer pathogenicity.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22461910 2012 FOXM1 induces a global methylation signature that mimics the cancer epigenome in head and neck squamous cell carcinoma.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21844189 2011 Intracellular erythrocyte platelet-activating factor acetylhydrolase I inactivates aspirin in blood.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19622634 2009 Opposing effects of Ndel1 and alpha1 or alpha2 on cytoplasmic dynein through competitive binding to Lis1.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11285245 2001 Functional hemizygosity of PAFAH1B3 due to a PAFAH1B3-CLK2 fusion gene in a female with mental retardation, ataxia and atrophy of the brain.
10727864 2000 Lissencephaly associated mutations suggest a requirement for the PAFAH1B heterotrimeric complex in brain development.
9693049 1998 The beta and gamma subunits of the human platelet-activating factor acetyl hydrolase isoform Ib (PAFAH1B2 and PAFAH1B3) map to chromosome 11q23 and 19q13.1, respectively.
9144386 1997 Differential tissue distribution of the beta- and gamma-subunits of human cytosolic platelet-activating factor acetylhydrolase (isoform I).
7669037 1995 cDNA cloning of human cytosolic platelet-activating factor acetylhydrolase gamma-subunit and its mRNA expression in human tissues.