Property Summary

NCBI Gene PubMed Count 27
PubMed Score 7.11
PubTator Score 10.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
juvenile dermatomyositis 1.016 9.8e-13
acute quadriplegic myopathy 1.012 2.8e-06
primary pancreatic ductal adenocarcinoma 1.334 9.3e-04
tuberculosis and treatment for 6 months 1.100 1.5e-03
lung cancer 1.400 6.0e-04
ovarian cancer -1.600 3.3e-06
pancreatic cancer 1.300 1.4e-03

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
492953 screening 4161 / 0 / 331300 Fluorescence polarization-based primary biochemical high throughput screening assay to identify inhibitors of human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (PAFAH1B2)
492971 summary 0 / 0 / 0 Summary of the probe development efforts to identify inhibitors of human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (PAFAH1B2)
493034 screening 2171 / 0 / 250 Fluorescence polarization-based biochemical high throughput confirmation assay for inhibitors of human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (PAFAH1B2)

Gene RIF (11)

PMID Text
25945974 PAFAH1B2 and 1B3 are important in maintaining cancer pathogenicity across a wide spectrum of cancer types.
25034894 The R92H and I198T polymorphisms are highly related to the plasma PAF-AH levels and the risk of coronary heart disease, especially among patients with blood stasis syndrome.
23508960 aspirin is hydrolyzed in plasma by two enzymes, BChE and a new extracellular form of platelet-activating factor acetylhydrolase, PAFAH1b2.
23238734 Knockdown of PAFAH1B2 strongly reduced Abeta secretion from human cells, and this effect was confirmed in primary cells derived from PAFAH1B2 knock-out mice
21866060 Plasma PAF-AH can hydrolyze oxidized phospholipids, and may attenuate the spreading of lipid peroxidation and participate in defense mechanisms against vasospasm after aneurysmal subarachnoid hemorrhage.
21844189 intracellular type I PAF acetylhydrolase (PAFAH1B2 and PAFAH1B3) is the major aspirin hydrolase of human blood
19622634 These results indicate an antagonistic effect of alpha1, alpha2 and Ndel1 for Lis1 binding, probably to modulate dynein functions in vivo.
19019335 Observational study of gene-disease association. (HuGE Navigator)
18155631 splice variants of the Pafah1b2 gene transcript retain exons 1-5 and replace exon 6 with alternative exons derived from genomic sequence 3' to exon 6. Splice variants encode two proteins with different novel carboxy termini
17849047 Observational study of gene-disease association. (HuGE Navigator)
17849047 PAFAH1B2 is not the gene responsible for the linkage evidence on chromosome 11q23 in protein C deficiency.

AA Sequence

MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALN      1 - 70
FGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLL     71 - 140
PRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLH    141 - 210
ELIMQLLEETPEEKQTTIA                                                       211 - 229
//

Text Mined References (34)

PMID Year Title
25945974 2015 Activity-Based Protein Profiling of Oncogene-Driven Changes in Metabolism Reveals Broad Dysregulation of PAFAH1B2 and 1B3 in Cancer.
25034894 2014 Associations of platelet-activating factor acetylhydrolase (PAF-AH) gene polymorphisms with circulating PAF-AH levels and risk of coronary heart disease or blood stasis syndrome in the Chinese Han population.
23508960 2013 Aspirin hydrolysis in plasma is a variable function of butyrylcholinesterase and platelet-activating factor acetylhydrolase 1b2 (PAFAH1b2).
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23238734 2012 Loss of PAFAH1B2 reduces amyloid-? generation by promoting the degradation of amyloid precursor protein C-terminal fragments.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22354037 2012 Genome-wide siRNA screen reveals amino acid starvation-induced autophagy requires SCOC and WAC.
21866060 2012 Plasma platelet-activating factor-acetyl hydrolase activity and the levels of free forms of biomarker of lipid peroxidation in cerebrospinal fluid of patients with aneurysmal subarachnoid hemorrhage.
21844189 2011 Intracellular erythrocyte platelet-activating factor acetylhydrolase I inactivates aspirin in blood.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19622634 2009 Opposing effects of Ndel1 and alpha1 or alpha2 on cytoplasmic dynein through competitive binding to Lis1.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
18464913 2008 A genome-wide association study identifies protein quantitative trait loci (pQTLs).
18155631 2008 Novel isoforms of intracellular platelet activating factor acetylhydrolase (PAFAH1b2) in human testis; encoded by alternatively spliced mRNAs.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17849047 2007 Exclusion of the alpha2 subunit of platelet-activating factor acetylhydrolase 1b (PAFAH1B2) as a prothrombotic gene in a protein C-deficient kindred and population-based case-control sample.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16130169 2005 Proteomics of human umbilical vein endothelial cells applied to etoposide-induced apoptosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11522926 2001 Preparation and crystal structure of the recombinant alpha(1)/alpha(2) catalytic heterodimer of bovine brain platelet-activating factor acetylhydrolase Ib.
10727864 2000 Lissencephaly associated mutations suggest a requirement for the PAFAH1B heterotrimeric complex in brain development.
9693049 1998 The beta and gamma subunits of the human platelet-activating factor acetyl hydrolase isoform Ib (PAFAH1B2 and PAFAH1B3) map to chromosome 11q23 and 19q13.1, respectively.
9144386 1997 Differential tissue distribution of the beta- and gamma-subunits of human cytosolic platelet-activating factor acetylhydrolase (isoform I).
8954729 1996 Platelet-activating factor acetylhydrolase expression and activity suggest a link between neuronal migration and platelet-activating factor.