Property Summary

NCBI Gene PubMed Count 116
PubMed Score 296.35
PubTator Score 320.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Multiple myeloma 1.125 6.5e-03
oligodendroglioma 1.100 6.3e-03
psoriasis -3.000 7.8e-06
osteosarcoma -1.874 1.2e-05
atypical teratoid / rhabdoid tumor -1.300 7.1e-06
glioblastoma -1.400 3.5e-04
medulloblastoma, large-cell -1.800 1.5e-03
hereditary spastic paraplegia -1.459 8.5e-03
limb girdle muscular dystrophy 2A -1.175 7.9e-04
tuberculosis -1.600 1.7e-06
adult high grade glioma -1.200 6.5e-05
group 4 medulloblastoma 1.500 2.3e-02
subependymal giant cell astrocytoma -3.006 1.7e-02
lung adenocarcinoma -1.300 4.2e-16
Alzheimer's disease -1.300 4.6e-02
Pick disease -1.700 3.5e-04
Breast cancer -1.200 6.4e-18
ovarian cancer 2.500 6.7e-04
Gaucher disease type 1 -1.500 1.2e-02
Down syndrome 1.100 1.5e-02
dermatomyositis -1.500 2.4e-03

Protein-protein Interaction (174)

SFI1   DCTN6   PLK4   NDC80   AURKA   XPO1   CEP290   NPHP1   ZW10   CCP110   BUB1   SSNA1   RAD21   BUB1B   DIAPH2   CLASP2   NPHP4   OFD1   DCTN3   HAUS5   CEP152   CCNB2   ZWINT   PCNT   FGFR1OP   TUBB4A   CDK1   TUBB   CCNB1   RAB6A   TUBG1   CLIP1   PPP1CC   CETN2   RPS27   RANGAP1   CENPF   RANBP2   KNTC1   NEK2   NUP98   PLK1   SEC13   NUP107   CDC42   RAB8A   RAB11A   TUBA4A   TUBB4B   PAFAH1B2   CENPE   GALNT2   GALNT1   CDC20   MAD2L1   ITGB3BP   DCTN2   DCTN1   SMC1A   IQCB1   PAFAH1B3   PCM1   MAPRE1   PDS5A   TCTN1   ERCC6L   C2CD3   CDCA8   SGO2   ODF2   SGO1   TMEM67   CEP78   KIF24   CEP162   CEP135   RPGRIP1L   HAUS3   CENPP   TTBK2   TCTN3   PMF1   BORA   CENPU   TUBA1A   CENPQ   TAOK1   CLASP1   HAUS6   WAPL   CNTRL   SDCCAG8   CEP57   CEP97   CENPL   AHI1   CENPS   STAG2   KIF2B   SPC24   NUP43   NUP37   KNL1   CEP70   NEDD1   KIF18A   CEP76   ALMS1   CEP192   FBF1   NUP133   SKA2   STAG1   AHCTF1   SKA1   CENPT   HAUS1   OPTN   SPDL1   SEH1L   CDCA5   DYNLL2   BICD1   AURKB   TCTN2   CENPN   AJUBA   NSL1   MARK4   CEP63   SCLT1   RAB3IP   CDK5RAP2   CEP89   HAUS7   B9D2   CENPK   HAUS8   DCTN5   CENPO   CEP250   NUP85   HDAC8   CEP41   NUF2   NDEL1   MIS12   CENPH   HAUS4   ZWILCH   SPC25   CENPJ   INCENP   TUBG2   CENPM   PDS5B   HAUS2   MKS1   NDE1   TMEM216   CEP72   RCC2   CC2D2A   DCTN4   TPX2   B9D1   CEP131   CEP164   SMC3   NUDC   NINL   CEP83   MAD1L1   DYNC1LI1  

Gene RIF (75)

PMID Text
26380866 In testis: varied levels among samples of different spermatogenic abilities, protein expression restricted to spermatogonia, spermatocytes and spermatids. Also varied levels in unfertilized oocytes, zygotes, cleavage stage embryos and blastocysts.
25479763 Results showed that miR-144 was reduced in cholangiocarcinoma tissues and suggested that miR-144 may be an essential suppresser of cholangiocarcinoma cell proliferation and invasion through targeting LIS1.
24928020 LIS1 and TSNAX genes are not associated with susceptibility to bipolar I disorder in Chinese Han population.
24487275 Identify a key role for Lis1 in hematopoietic stem cells and mark its directed control of asymmetric division as a critical regulator of normal and malignant hematopoietic development
23813913 LIS1 gene duplication is associated with developmental, behavioral and brain abnormalities.
22956769 LIS1 is required for dynein-mediated transport induced by membrane tethering of BICD2-N and LIS1 contributes to dynein accumulation at microtubule plus ends and BICD2-positive cellular structures.
22749159 PAFAH1B1 overexpression contributes to lung tumorigenesis and poor prognosis.
22373868 Studies indicate that binding of dynactin, LIS1 and NudEL regulate cytoplasmic dynein motor activity.
22328561 Studies identified three genes, CHD5, PAFAH1B1, and NME1, strongly associated with patient outcome.
22006948 cell type-restricted role for LIS1 in large vesicular transport and quantitative support for a general role for LIS1 in high-load dynein functions.
21911489 Mutually exclusive cytoplasmic dynein regulation by NudE-Lis1 and dynactin.
21890215 The results did not detect a significant association. It indicated that common genetic variations in LIS1 genes might not play a role in the genetic predisposition to autism.
21652625 we have identified a so-far-unknown interaction between LIS1 and PDE4 isoforms, whereby PDE4 can modulate LIS1-dynein complexes and dynein-dependent processes within cells by sequestering LIS1.
21593204 PAFAH Ib regulates endocytic membrane trafficking through novel mechanisms involving both PLA(2) activity and LIS1-dependent dynein function
21569763 these results suggest that LIS1 plays a potential tumor suppressor role in the development and progression of hepatocellular carcinoma.
21107783 Single nucleotide polymorphism in PAFAH1B1 gene is associated with Myelodysplastic Syndromes.
21092859 Lis1 is cell-autonomously required for cortical neuron and astrocyte production and is involved in neuronal migration.
21036906 The truncated monomeric form of LIS1 had little effect on dynein motility, but an artificial dimer of truncated LIS1 suppressed dynein motility, which was restored by the N-terminal fragment of NDEL1.
20675372 NudC may be involved in the regulation of LIS1 stability by its chaperone function.
20673868 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20464283 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20168084 Findings suggest that physiological functions of LIS1 and NDEL1 in neurons have been ascribed for proteins fundamentally required for cell cycle progression and control.
20140262 Observational study of gene-disease association. (HuGE Navigator)
20133715 NudCL2, a homolog of Aspergillus NudC, which shares significant homology with human NudC and NudCL was identified. It regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90 chaperone.
20084519 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20048338 NDE1 and NDEL1 act upstream of LIS1 in dynein recruitment, and/or activation, on the membrane.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19667223 Our results confirm the homogeneity profile of patients with LIS1-related lissencephaly who demonstrate in a large proportion Dobyns lissencephaly grade 3a, and the absence of correlation with LIS1 mutations.
19667223 Observational study of gene-disease association. (HuGE Navigator)
19632097 There was no strong evidence for association with LIS1 in schizophrenia.
19632097 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19622634 These results indicate an antagonistic effect of alpha1, alpha2 and Ndel1 for Lis1 binding, probably to modulate dynein functions in vivo.
19527514 Observational study of gene-disease association. (HuGE Navigator)
19251251 Observational study of gene-disease association. (HuGE Navigator)
19136950 An increase in LIS1 expression in the developing brain results in brain abnormalities in mice and humans.
19050731 intragenic deletions and duplications of the LIS1 gene account for a significant number of patients with isolated lissencephaly sequence and subcortical band heterotopia, where no molecular defect had previously been identified.
19020519 these results suggest that complexes of dynein, Lis1 and CLIP-170 crosslink and slide microtubules within the spindle, thereby producing an inward force that pulls centrosomes together.
19019335 Observational study of gene-disease association. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18784752 Data show that LIS1 suppresses the motility of cytoplasmic dynein on microtubules, whereas NDEL1 releases the blocking effect of LIS1 on cytoplasmic dynein.
18524253 regulates cytoplasmic dynein. [review]
18431085 Observational study of gene-disease association. (HuGE Navigator)
18421979 LIS1 regulates cytoplasmic dynein and plays an important role on the determination cleavage plane of neuronal progenitor cells.
18285425 The high frequency of genomic deletions/duplications of LIS1 is in keeping with the over representation of Alu elements in the 17p13.3 region.
17850624 LIS1 has a role in lissencephaly, neuronal migration and development [review]
17664403 Neither type nor position of intragenic mutations in the LIS1 gene allows prediction of the phenotypic severity. Patients presenting with mild cerebral malformations should be considered for genetic analysis of the LIS1 gene.
17018134 Our results show that inhibition of PP2A by LIS1 induces HIV-1 transcription. Our results also point to a possibility that LIS1 might function in the cells as a yet unrecognized regulatory subunit of PP2A.
17018134 Inhibition of PP2A by LIS1 increases Tat mediated HIV-1 transcription
16766276 Observational study of gene-disease association. (HuGE Navigator)
16761416 Observational study of gene-disease association. (HuGE Navigator)
16689754 Observational study of gene-disease association. (HuGE Navigator)
16642511 in addition to migration, disruption in cell proliferation could play a more important role in the development of lissencephaly than previously suspected
16549273 Observational study of gene-disease association. (HuGE Navigator)
16411107 Observational study of gene-disease association. (HuGE Navigator)
16258276 Mutations within the LisH (LIS1 homology)motif are likely to result in pathogenic consequences in genes associated with genetic diseases.
16144905 LIS1 RNA interference blocks neural stem cell division, morphogenesis, and motility at multiple stages.
16138011 use of poliovirus protein as a research tool allowed us to reveal the role of cellular protein LIS1 in membrane protein trafficking, maintenance of Golgi integrity, surface presentation of unstable receptors
16086290 Observational study of gene-disease association. (HuGE Navigator)
16027700 Observational study of gene-disease association. (HuGE Navigator)
16027700 V279F polymorphism in the plasma PAF-AH gene and consequent enzymatic deficiency is an important factor for IVIG nonresponse in Japanese patients with acute KD.
15698475 Our results indicate that Tat interacts with LIS1 in vitro and in vivo and that this interaction might contribute to the effect of Tat on microtubule formation.
15698475 Inhibition of PP2A by LIS1 increases Tat mediated HIV-1 transcription
15081260 Observational study of gene-disease association. (HuGE Navigator)
15057976 LIS1 maps at 17p13.3 and is the result of a heterozygous mutation. It acts during corticogenesis on radial migratory pathways.
12885786 LIS1 missense mutations result in variable phenotypes
12496397 The propensity of monocytes in juvenile periodontitis patients to differentiate into monocyte-derived dendritic cells results in lower levels of PAFAH and allows platelet activating factor to promote production of a protective IgG2 antibody response.
12185771 Lissencephaly with posteriorly predominant gyral abnormality is caused by mutations of the LIS1 gene on chromosome 17.
12110797 Observational study of gene-disease association. (HuGE Navigator)
11940666 LIS1, CLIP-170's key to the dynein/dynactin pathway
11916011 Val279Phe polymorphism is activity-deficient and is associated with increased risk of childhood atopic asthma.
11889140 Together, our data suggest a novel role for LIS1 in mediating CLIP-170-dynein interactions and in coordinating dynein cargo-binding and motor activities.
11803439 LIS1 has a principle role in brain development.Hemizygote mutations result in a severe brain malformation known as lissencephaly. It is a WD repeat protein involved in several protein complexes that may play a functional role in brain development.

AA Sequence

MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELES      1 - 70
KLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETG     71 - 140
DFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSA    141 - 210
SRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVE    211 - 280
CISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGG    281 - 350
KFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR              351 - 410
//

Text Mined References (121)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26380866 2015 Role of PAFAH1B1 in human spermatogenesis, fertilization and early embryonic development.
25479763 2014 MicroRNA-144 suppresses cholangiocarcinoma cell proliferation and invasion through targeting platelet activating factor acetylhydrolase isoform 1b.
24928020 2014 [Association study of LIS1 and TSNAX genes with bipolar disorder in Chinese Han population].
24487275 2014 Lis1 regulates asymmetric division in hematopoietic stem cells and in leukemia.
23813913 2013 The duplication 17p13.3 phenotype: analysis of 21 families delineates developmental, behavioral and brain abnormalities, and rare variant phenotypes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23097494 2012 Human Asunder promotes dynein recruitment and centrosomal tethering to the nucleus at mitotic entry.
22956769 2012 BICD2, dynactin, and LIS1 cooperate in regulating dynein recruitment to cellular structures.
22749159 2012 Overexpression of PAFAH1B1 is associated with tumor metastasis and poor survival in non-small cell lung cancer.
22373868 2012 Multiple modes of cytoplasmic dynein regulation.
22328561 2012 A three-gene expression signature model for risk stratification of patients with neuroblastoma.
22006948 2011 High-resolution imaging reveals indirect coordination of opposite motors and a role for LIS1 in high-load axonal transport.
21911489 2011 Mutually exclusive cytoplasmic dynein regulation by NudE-Lis1 and dynactin.
21890215 2011 No association of polymorphisms in the CDK5, NDEL1, and LIS1 with autism in Chinese Han population.
21652625 2011 Interaction between LIS1 and PDE4, and its role in cytoplasmic dynein function.
21593204 2011 The phospholipase A? enzyme complex PAFAH Ib mediates endosomal membrane tubule formation and trafficking.
21569763 2011 The human LIS1 is downregulated in hepatocellular carcinoma and plays a tumor suppressor function.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
21107783 2011 A new case of duplication of the MDS region identified by high-density SNP arrays and a review of the literature.
21092859 2010 Genetic mosaic dissection of Lis1 and Ndel1 in neuronal migration.
21036906 2011 Functional dissection of LIS1 and NDEL1 towards understanding the molecular mechanisms of cytoplasmic dynein regulation.
20675372 2010 The L279P mutation of nuclear distribution gene C (NudC) influences its chaperone activity and lissencephaly protein 1 (LIS1) stability.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20464283 2010 Study of association between genetic polymorphisms of phospholipase A2 enzymes and Alzheimer's disease.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20360068 2010 Systematic analysis of human protein complexes identifies chromosome segregation proteins.
20168084 The essential role of LIS1, NDEL1 and Aurora-A in polarity formation and microtubule organization during neurogensis.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
20133715 2010 NudC-like protein 2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90.
20084519 2010 Evidence of statistical epistasis between DISC1, CIT and NDEL1 impacting risk for schizophrenia: biological validation with functional neuroimaging.
20048338 2010 Functional interplay between LIS1, NDE1 and NDEL1 in dynein-dependent organelle positioning.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19667223 2009 LIS1-related isolated lissencephaly: spectrum of mutations and relationships with malformation severity.
19632097 2009 Genetic association and post-mortem brain mRNA analysis of DISC1 and related genes in schizophrenia.
19622634 2009 Opposing effects of Ndel1 and alpha1 or alpha2 on cytoplasmic dynein through competitive binding to Lis1.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19251251 2009 Association between genes of Disrupted in schizophrenia 1 (DISC1) interactors and schizophrenia supports the role of the DISC1 pathway in the etiology of major mental illnesses.
19136950 2009 Increased LIS1 expression affects human and mouse brain development.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19050731 2009 Intragenic deletions and duplications of the LIS1 and DCX genes: a major disease-causing mechanism in lissencephaly and subcortical band heterotopia.
19020519 2008 Dynein, Lis1 and CLIP-170 counteract Eg5-dependent centrosome separation during bipolar spindle assembly.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18784752 2008 LIS1 and NDEL1 coordinate the plus-end-directed transport of cytoplasmic dynein.
18524253 2008 [Molecular mechanism of lissencephaly: how LIS1 regulates cytoplasmic dynein].
18431085 2008 Platelet activating factor-acetylhydrolase (PAF-AH) activity and HDL levels, but not PAF-AH gene polymorphisms, are associated with successful aging in Sicilian octogenarians.
18421979 2008 [Molecular mechanism of lissencephaly--how LIS1 and NDEL1 regulate cytoplasmic dynein?].
18285425 2008 High frequency of genomic deletions--and a duplication--in the LIS1 gene in lissencephaly: implications for molecular diagnosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17850624 2007 Lissencephaly and LIS1: insights into the molecular mechanisms of neuronal migration and development.
17664403 2007 Location and type of mutation in the LIS1 gene do not predict phenotypic severity.
17018134 2006 Inhibition of PP2A by LIS1 increases HIV-1 gene expression.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16766276 2006 Association of platelet-activating factor acetylhydrolase gene polymorphism with premature coronary artery disease in Turkish patients.
16761416 2006 [Correlation between desmin gene, platelet-activating factor acetylhydrolase gene and dilated cardiomyopathy].
16689754 2006 Platelet-activating factor-acetylhydrolase A379V (exon 11) gene polymorphism is an independent and functional risk factor for premature myocardial infarction.
16642511 2006 Impaired proliferation and migration in human Miller-Dieker neural precursors.
16549273 2006 Variations in genes regulating neuronal migration predict reduced prefrontal cognition in schizophrenia and bipolar subjects from mediterranean Spain: a preliminary study.
16462731 2006 The PITSLRE/CDK11p58 protein kinase promotes centrosome maturation and bipolar spindle formation.
16411107 2006 Paraoxonase 1 gene polymorphisms influence clinical features of open-angle glaucoma.
16258276 2005 Novel functional features of the Lis-H domain: role in protein dimerization, half-life and cellular localization.
16144905 2005 LIS1 RNA interference blocks neural stem cell division, morphogenesis, and motility at multiple stages.
16138011 2005 Poliovirus protein 3A binds and inactivates LIS1, causing block of membrane protein trafficking and deregulation of cell division.
16086290 2005 [Analysis of 994(G--> T) mutation in the plasma platelet-activating factor acetylhydrolase gene in the patients with cerebral infarction].
16027700 2005 A polymorphism in plasma platelet-activating factor acetylhydrolase is involved in resistance to immunoglobulin treatment in Kawasaki disease.
15762842 2005 Binding of microtubule-associated protein 1B to LIS1 affects the interaction between dynein and LIS1.
15698475 2005 HIV-1 Tat interacts with LIS1 protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15173193 2004 Lis1 and doublecortin function with dynein to mediate coupling of the nucleus to the centrosome in neuronal migration.
15081260 2004 Platelet-activating factor acetylhydrolase gene polymorphism and its activity in Japanese patients with multiple sclerosis.
15057976 2004 Neocortical neuronal arrangement in LIS1 and DCX lissencephaly may be different.
15007136 2004 Mutation screening in a cohort of patients with lissencephaly and subcortical band heterotopia.
14970193 2004 Nudel functions in membrane traffic mainly through association with Lis1 and cytoplasmic dynein.
14962739 2004 Disrupted in Schizophrenia 1 and Nudel form a neurodevelopmentally regulated protein complex: implications for schizophrenia and other major neurological disorders.
14733918 2004 Screening of Hsp105alpha-binding proteins using yeast and bacterial two-hybrid systems.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14584027 2003 LIS1 association with dynactin is required for nuclear motility and genomic union in the fertilized mammalian oocyte.
14581661 2003 Mosaic mutations of the LIS1 gene cause subcortical band heterotopia.
14578885 2003 Interaction of reelin signaling and Lis1 in brain development.
12885786 2003 LIS1 missense mutations: variable phenotypes result from unpredictable alterations in biochemical and cellular properties.
12852856 2003 Polo-like kinase 1 regulates Nlp, a centrosome protein involved in microtubule nucleation.
12556484 2003 Human Nudel and NudE as regulators of cytoplasmic dynein in poleward protein transport along the mitotic spindle.
12496397 2003 Differential expression of platelet-activating factor acetylhydrolase in macrophages and monocyte-derived dendritic cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12221128 2002 Centrosomal proteins CG-NAP and kendrin provide microtubule nucleation sites by anchoring gamma-tubulin ring complex.
12185771 2002 Epileptogenic brain malformations: clinical presentation, malformative patterns and indications for genetic testing.
12110797 2002 Single nucleotide polymorphism (G994-->T) in the plasma platelet-activating factor-acetylhydrolase gene is associated with graft patency of femoropopliteal bypass.
11940666 2002 LIS1, CLIP-170's key to the dynein/dynactin pathway.
11889140 2002 Role of dynein, dynactin, and CLIP-170 interactions in LIS1 kinetochore function.
11803439 2002 LIS1-no more no less.
11734602 2001 NudC associates with Lis1 and the dynein motor at the leading pole of neurons.
11502906 2001 LIS1 missense mutations cause milder lissencephaly phenotypes including a child with normal IQ.
11294621 2001 Platelet-activating factor acetylhydrolases: broad substrate specificity and lipoprotein binding does not modulate the catalytic properties of the plasma enzyme.
11163260 2000 NUDEL is a novel Cdk5 substrate that associates with LIS1 and cytoplasmic dynein.
11163258 2000 LIS1 regulates CNS lamination by interacting with mNudE, a central component of the centrosome.
11076968 2000 The centrosomal protein C-Nap1 is required for cell cycle-regulated centrosome cohesion.
11056532 2000 A role for the lissencephaly gene LIS1 in mitosis and cytoplasmic dynein function.
11001923 2000 Interaction between LIS1 and doublecortin, two lissencephaly gene products.
10931877 2000 The LIS1-related NUDF protein of Aspergillus nidulans interacts with the coiled-coil domain of the NUDE/RO11 protein.
10729324 2000 Hippocampal abnormalities and enhanced excitability in a murine model of human lissencephaly.
10727864 2000 Lissencephaly associated mutations suggest a requirement for the PAFAH1B heterotrimeric complex in brain development.
10491172 1999 LIS1 is a microtubule-associated phosphoprotein.
10441340 1999 Subcortical band heterotopia in rare affected males can be caused by missense mutations in DCX (XLIS) or LIS1.
9626899 1998 Roles of plasma platelet-activating factor acetylhydrolase in allergic, inflammatory, and atherosclerotic diseases.
9601647 1998 The lissencephaly gene product Lis1, a protein involved in neuronal migration, interacts with a nuclear movement protein, NudC.
9384577 1997 Reduction of microtubule catastrophe events by LIS1, platelet-activating factor acetylhydrolase subunit.
9218411 1997 Platelet-activating factor acetylhydrolases.
9131135 1996 Functional and structural features of plasma platelet-activating factor acetylhydrolase.
9063735 1997 Point mutations and an intragenic deletion in LIS1, the lissencephaly causative gene in isolated lissencephaly sequence and Miller-Dieker syndrome.
9044400 1997 Expression of the LIS-1 gene product in brain anomalies with a migration disorder.
8586424 1995 LIS2, gene and pseudogene, homologous to LIS1 (lissencephaly 1), located on the short and long arms of chromosome 2.
8355785 1993 Isolation of a Miller-Dieker lissencephaly gene containing G protein beta-subunit-like repeats.
8028668 1994 Miller-Dieker lissencephaly gene encodes a subunit of brain platelet-activating factor acetylhydrolase [corrected].
7790358 1995 Cell cycle regulation of the activity and subcellular localization of Plk1, a human protein kinase implicated in mitotic spindle function.
7573359 1995 Lissencephaly gene product. Localization in the central nervous system and loss of immunoreactivity in Miller-Dieker syndrome.