Property Summary

NCBI Gene PubMed Count 124
PubMed Score 294.60
PubTator Score 320.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Lissencephaly 69 8.564 4.0
Carcinogenesis 8 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -1.200 6.5e-05
Alzheimer's disease -1.300 4.6e-02
atypical teratoid / rhabdoid tumor -1.300 7.1e-06
Breast cancer -1.200 6.4e-18
dermatomyositis -1.500 2.4e-03
Down syndrome 1.100 1.5e-02
Gaucher disease type 1 -1.200 1.2e-02
glioblastoma -1.400 3.5e-04
group 4 medulloblastoma 1.500 2.3e-02
hereditary spastic paraplegia -1.459 8.5e-03
limb girdle muscular dystrophy 2A -1.175 7.9e-04
lung adenocarcinoma -1.300 4.2e-16
medulloblastoma, large-cell -1.800 1.5e-03
Multiple myeloma 1.125 6.5e-03
oligodendroglioma 1.100 6.3e-03
osteosarcoma -1.630 1.5e-06
ovarian cancer -2.400 6.3e-08
Pick disease -1.200 7.8e-04
psoriasis -3.000 7.8e-06
subependymal giant cell astrocytoma -1.977 2.9e-03
tuberculosis -1.600 1.7e-06

Synonym

Accession P43034 B2R7Q7 Q8WZ88 Q8WZ89
Symbols MDS
LIS1
LIS2
MDCR
NudF
PAFAH

Gene

Protein-protein Interaction (2)

Gene RIF (81)

AA Sequence

MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELES      1 - 70
KLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETG     71 - 140
DFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSA    141 - 210
SRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVE    211 - 280
CISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGG    281 - 350
KFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR              351 - 410
//

Text Mined References (129)

PMID Year Title