Property Summary

NCBI Gene PubMed Count 25
PubMed Score 5.14
PubTator Score 6.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.300 2.0e-05
Atopic dermatitis 1.100 9.5e-05
lung cancer 1.100 7.1e-04
diabetes mellitus -1.100 5.3e-03
group 4 medulloblastoma -1.200 9.5e-04

Gene RIF (4)

PMID Text
24500282 Show that in neuroendocrine chromaffin cells fusion pore expansion and catecholamine release are limited specifically by mutation of syndapin 3.
22573331 Rigidity of wedge loop in PACSIN 3 protein is a key factor in dictating diameters of tubules
18174177 PACSIN 3 acts as an auxiliary protein of TRPV4 channel that not only affects the channel's subcellular localization but also modulates its function in a stimulus-specific manner.
12952982 PACSIN3 has a novel function as an up-regulator in the signaling of proHB-EGF shedding induced by TPA and angiotensin II

AA Sequence

MAPEEDAGGEALGGSFWEAGNYRRTVQRVEDGHRLCGDLVSCFQERARIEKAYAQQLADWARKWRGTVEK      1 - 70
GPQYGTLEKAWHAFFTAAERLSALHLEVREKLQGQDSERVRAWQRGAFHRPVLGGFRESRAAEDGFRKAQ     71 - 140
KPWLKRLKEVEASKKSYHAARKDEKTAQTRESHAKADSAVSQEQLRKLQERVERCAKEAEKTKAQYEQTL    141 - 210
AELHRYTPRYMEDMEQAFETCQAAERQRLLFFKDMLLTLHQHLDLSSSEKFHELHRDLHQGIEAASDEED    211 - 280
LRWWRSTHGPGMAMNWPQFEEWSLDTQRTISRKEKGGRSPDEVTLTSIVPTRDGTAPPPQSPGSPGTGQD    281 - 350
EEWSDEESPRKAATGVRVRALYDYAGQEADELSFRAGEELLKMSEEDEQGWCQGQLQSGRIGLYPANYVE    351 - 420
CVGA                                                                      421 - 424
//

Text Mined References (34)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24500282 2014 Syndapin 3 modulates fusion pore expansion in mouse neuroendocrine chromaffin cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23236520 2012 Versatile membrane deformation potential of activated pacsin.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22573331 2012 Rigidity of wedge loop in PACSIN 3 protein is a key factor in dictating diameters of tubules.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18316326 2008 Exploration of human ORFeome: high-throughput preparation of ORF clones and efficient characterization of their protein products.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18174177 2008 Stimulus-specific modulation of the cation channel TRPV4 by PACSIN 3.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16627472 2006 PACSINs bind to the TRPV4 cation channel. PACSIN 3 modulates the subcellular localization of TRPV4.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16374509 2006 Identification of preferred protein interactions by phage-display of the human Src homology-3 proteome.
16318909 2006 Regulation of FasL expression: a SH3 domain containing protein family involved in the lysosomal association of FasL.
15719014 2005 Expression of AMAP1, an ArfGAP, provides novel targets to inhibit breast cancer invasive activities.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15280379 2004 ADAM binding protein Eve-1 is required for ectodomain shedding of epidermal growth factor receptor ligands.
15226389 2004 The syndapin protein family: linking membrane trafficking with the cytoskeleton.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14679214 2004 A novel proteomic screen for peptide-protein interactions.
12952982 2003 PACSIN3 binds ADAM12/meltrin alpha and up-regulates ectodomain shedding of heparin-binding epidermal growth factor-like growth factor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11179684 2001 PACSIN 3 is a novel SH3 domain cytoplasmic adapter protein of the pacsin-syndapin-FAP52 gene family.
11082044 2000 All three PACSIN isoforms bind to endocytic proteins and inhibit endocytosis.
10531379 1999 Interaction of the metalloprotease disintegrins MDC9 and MDC15 with two SH3 domain-containing proteins, endophilin I and SH3PX1.