Property Summary

NCBI Gene PubMed Count 33
PubMed Score 44.31
PubTator Score 27.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytoma -2.800 1.4e-18
ependymoma -5.400 8.3e-31
oligodendroglioma -3.100 1.7e-18
glioblastoma -5.000 9.3e-09
osteosarcoma -1.047 8.3e-04
sonic hedgehog group medulloblastoma -4.700 1.9e-10
atypical teratoid / rhabdoid tumor -5.500 1.3e-16
medulloblastoma, large-cell -4.400 7.7e-07
primitive neuroectodermal tumor -4.400 1.5e-06
intraductal papillary-mucinous adenoma (... -1.100 2.9e-03
intraductal papillary-mucinous neoplasm ... -1.300 1.0e-02
pediatric high grade glioma -5.000 4.3e-11
pilocytic astrocytoma -5.600 3.1e-17
subependymal giant cell astrocytoma -3.466 2.7e-02
inflammatory breast cancer 1.300 3.9e-02
pituitary cancer 1.600 8.8e-05

 GO Function (1)

Gene RIF (9)

PMID Text
24751538 syndapin I functions reflected direct, SH3 domain-mediated associations and functional interactions with ProSAP1/Shank2.
24205826 Specifically, CKS1B and MAP2K5 significantly inhibited hepatitis C viral RNA replication. PACSIN1, by contrast, inhibited hepatitis C virus infection by decreasing the level of viral protein p7.
23898200 Data indicate that the structural capacity of N17 to fold back toward distal regions within huntingtin requires an interacting protein, protein kinase C and casein kinase 2 substrate in neurons 1 (PACSIN1).
23236520 Pacsin-1 plays a versatile role in sculpting cellular membranes that is likely dependent both on protein structure and membrane properties.
22488361 PACSIN1 represents a pDC-specific adaptor molecule that plays an important role in the TLR7/9-mediated type I IFN responses by pDCs in vitro and in vivo.
22355135 Phosphorylation of syndapin I F-BAR domain at two helix-capping motifs regulates membrane tubulation
20057076 PACSIN 1 (1-344) was crystallized & diffracted to resolution of 3.0 A. The crystal belonged to space group C2, with unit-cell parameters a=158.65, b=87.38, c=91.76 A, alpha=90.00, beta=113.61, gamma=90.00 degrees. There are 2 molecules in asymmetric unit.
19549836 The regulated deformation of membranes and promotion of tubule constrictions by Pacsin suggests a more versatile function of these proteins in vesiculation and endocytosis.
18649358 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSSSYDEASLAPEETTDSFWEVGNYKRTVKRIDDGHRLCNDLMNCVQERAKIEKAYGQQLTDWAKRWRQL      1 - 70
IEKGPQYGSLERAWGAIMTEADKVSELHQEVKNNLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFR     71 - 140
KAQKPWAKKMKELEAAKKAYHLACKEEKLAMTREMNSKTEQSVTPEQQKKLQDKVDKCKQDVQKTQEKYE    141 - 210
KVLEDVGKTTPQYMENMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADA    211 - 280
QEDLRWFRSTSGPGMPMNWPQFEEWNPDLPHTTTKKEKQPKKAEGVALTNATGAVESTSQAGDRGSVSSY    281 - 350
DRGQPYATEWSDDESGNPFGGSETNGGANPFEDDSKGVRVRALYDYDGQEQDELSFKAGDELTKLGEEDE    351 - 420
QGWCRGRLDSGQLGLYPANYVEAI                                                  421 - 444
//

Text Mined References (35)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24751538 2014 ProSAP1 and membrane nanodomain-associated syndapin I promote postsynapse formation and function.
24205826 2014 Identification of novel human kinases that suppress hepatitis C virus infection.
23898200 2013 Polyglutamine domain flexibility mediates the proximity between flanking sequences in huntingtin.
23236520 2012 Versatile membrane deformation potential of activated pacsin.
22573331 2012 Rigidity of wedge loop in PACSIN 3 protein is a key factor in dictating diameters of tubules.
22488361 2012 PACSIN1 regulates the TLR7/9-mediated type I interferon response in plasmacytoid dendritic cells.
22355135 2012 Phosphorylation of syndapin I F-BAR domain at two helix-capping motifs regulates membrane tubulation.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20936779 2010 A human MAP kinase interactome.
20057076 2010 Crystallization and preliminary X-ray crystallographic analysis of human PACSIN 1 protein.
19549836 2009 Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
18649358 2008 Replication of a genome-wide case-control study of esophageal squamous cell carcinoma.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17500595 2007 Huntingtin interacting proteins are genetic modifiers of neurodegeneration.
17161366 2006 Structural insights into the specific binding of huntingtin proline-rich region with the SH3 and WW domains.
16627472 2006 PACSINs bind to the TRPV4 cation channel. PACSIN 3 modulates the subcellular localization of TRPV4.
16381901 2006 The LIFEdb database in 2006.
16318909 2006 Regulation of FasL expression: a SH3 domain containing protein family involved in the lysosomal association of FasL.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15252009 2004 A novel dynamin-associating molecule, formin-binding protein 17, induces tubular membrane invaginations and participates in endocytosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12354780 2002 PACSIN 1 interacts with huntingtin and is absent from synaptic varicosities in presymptomatic Huntington's disease brains.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11352907 2001 The Ras/Rac guanine nucleotide exchange factor mammalian Son-of-sevenless interacts with PACSIN 1/syndapin I, a regulator of endocytosis and the actin cytoskeleton.
11292345 2001 Selection of ligands by panning of domain libraries displayed on phage lambda reveals new potential partners of synaptojanin 1.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11179684 2001 PACSIN 3 is a novel SH3 domain cytoplasmic adapter protein of the pacsin-syndapin-FAP52 gene family.
11082044 2000 All three PACSIN isoforms bind to endocytic proteins and inhibit endocytosis.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.
9950691 1999 Syndapin I, a synaptic dynamin-binding protein that associates with the neural Wiskott-Aldrich syndrome protein.