Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.13

Knowledge Summary

Patent

No data available

Expression

 Compartment GO Term (2)

AA Sequence

MQKSEGSGGTQLKNRATGNYDQRTSSSTQLKHRNAVQGSKSSLSTSSPESARKLHPRPSDKLNPKTINPF      1 - 70
GEQSRVPSAFAAIYSKGGIPCRLVHGSVKHRLQWECPPESLSFDPLLITLAEGLRETKHPYTFVSKEGFR     71 - 140
ELLLVKGAPEKAIPLLPRLIPVLKAALVHSDDEVFERGLNALVQLSVVVGPSLNDHLKHLLTSLSKRLMD    141 - 210
KKFKEPITSALQKLEQHGGSGSLSIIKSKIPTYCSICC                                    211 - 248
//

Text Mined References (8)

PMID Year Title