PACRG-like protein

Property Summary

NCBI Gene PubMed Count	7
PubMed Score	0.13

Knowledge Summary

Patent

No data available

TINX Plot

Disease (2)

Expression Atlas
JensenLab Experiment COSMIC

Disease	Target Count	P-value
osteosarcoma	7950	4.1e-07
posterior fossa group B ependymoma	416	3.4e-06
group 3 medulloblastoma	4104	6.4e-04
ovarian cancer	8520	1.2e-03
intraductal papillary-mucinous adenoma (IPMA)	2955	3.0e-03
intraductal papillary-mucinous carcinoma (IPMC)	2989	1.9e-02
intraductal papillary-mucinous neoplasm (IPMN)	3291	3.3e-02

Disease	Target Count	Z-score	Confidence
Carcinoma	11493	0.0	0.7

Differential Expression (7)

Disease	log2 FC	p
group 3 medulloblastoma	1.700	6.4e-04
intraductal papillary-mucinous adenoma (...	1.600	3.0e-03
intraductal papillary-mucinous carcinoma...	1.500	1.9e-02
intraductal papillary-mucinous neoplasm ...	1.400	3.3e-02
osteosarcoma	-2.404	4.1e-07
ovarian cancer	1.200	1.2e-03
posterior fossa group B ependymoma	1.200	3.4e-06

Testis 18,518

Uterus 17,618

Ovary 17,971

Thyroid 18,024

Nerve - Tibial 18,007

Vagina 17,834

Artery - Coronary 17,949

Cells - Transformed fibroblasts 17,577

Pituitary 18,147

Colon - Sigmoid 18,089

Artery - Aorta 17,896

Artery - Tibial 17,631

Adipose - Subcutaneous 18,110

Breast - Mammary Tissue 18,103

Adipose - Visceral (Omentum) 17,937

Esophagus - Gastroesophageal Junction 18,000

Prostate 18,213

Esophagus - Muscularis 18,017

Spleen 17,614

Skin - Sun Exposed (Lower leg) 17,968

Brain - Spinal cord (cervical c-1) 17,973

Brain - Frontal Cortex (BA9) 18,069

Skin - Not Sun Exposed (Suprapubic) 18,081

Brain - Nucleus accumbens (basal ganglia... 18,024

Brain - Hypothalamus 18,169

Lung 18,057

Brain - Cortex 18,039

Stomach 17,879

Minor Salivary Gland 18,005

Brain - Caudate (basal ganglia) 18,001

Adrenal Gland 18,071

Esophagus - Mucosa 18,076

Brain - Cerebellar Hemisphere 18,015

Brain - Anterior cingulate cortex (BA24) 17,989

Brain - Cerebellum 17,983

Brain - Substantia nigra 17,981

Cells - EBV-transformed lymphocytes 18,186

Small Intestine - Terminal Ileum 17,954

Brain - Hippocampus 18,011

Brain - Amygdala 18,006

Colon - Transverse 17,825

Brain - Putamen (basal ganglia) 17,863

Heart - Atrial Appendage 17,896

Kidney - Cortex 17,329

Pancreas 18,123

Muscle - Skeletal 17,778

Liver 18,071

Heart - Left Ventricle 18,006

Whole Blood 17,439

Adult Testis 10,836

Adult Liver 9,113

Adult Ovary 10,192

Adult Frontal Cortex 9,048

Ovary

Testis

adipose tissue 15,837

adrenal gland 15,963

appendix 16,247

bone marrow 14,571

breast 16,063

cerebral cortex 16,630

cervix, uterine 15,871

colon 15,959

duodenum 15,975

endometrium 16,349

epididymis 15,863

esophagus 15,898

fallopian tube 16,245

gallbladder 16,333

heart muscle 14,972

kidney 15,917

liver 14,587

lung 16,312

lymph node 15,833

ovary 15,408

pancreas 14,070

parathyroid gland 14,769

placenta 15,937

prostate 16,460

rectum 15,705

salivary gland 14,981

seminal vesicle 15,918

skeletal muscle 14,011

skin 16,206

small intestine 16,154

smooth muscle 15,857

spleen 15,972

stomach 16,099

testis 17,936

thyroid gland 15,959

tonsil 15,400

urinary bladder 15,814

Liver and Pancreas 16,750

Digestive Tract 17,369

Urinary Tract 16,678

Endocrine System 18,159

Blood and immune system 16,909

Respiratory system 16,393

Female tissues 17,400

Male tissues 17,142

Skin and soft tissues 17,230

Nervous System 16,725

Cardiovascular System 15,192

Synonym

Accession	Q8N7B6 B2RDB9 B4DFF8 B4DMN7 Q8TBA8
Symbols	C4orf28

Gene

PACRGL

Ortholog (13)

Species	Source	Disease
Chimp 14,140	OMA EggNOG
Mouse 16,570	Inparanoid OMA EggNOG
Macaque 12,761	Inparanoid OMA EggNOG
Dog 15,073	Inparanoid OMA EggNOG
Rat 15,117	Inparanoid OMA EggNOG
Cow 15,320	Inparanoid OMA EggNOG
Horse 14,252	Inparanoid OMA EggNOG
Opossum 12,230	Inparanoid OMA EggNOG
Pig 10,168	OMA EggNOG
Chicken 7,827	Inparanoid OMA EggNOG
Platypus 5,703	OMA EggNOG
Xenopus 10,468	Inparanoid OMA EggNOG
Anole lizard 10,588	Inparanoid OMA EggNOG

UniProt Keyword (5)

Complete proteome 20,231

Reference proteome 20,231

Alternative splicing 10,528

Phosphoprotein 8,216

Acetylation 3,409

Compartment GO Term (2)

Nucleoplasm 5,077

Vesicles 1,613

HCA RNA Cell Line (56)

A-431 16,131

A549 15,174

AF22 16,160

AN3-CA 15,648

ASC TERT1 14,842

BEWO 16,726

BJ 15,448

BJ hTERT+ 15,353

BJ hTERT+ SV40 Large T+ 15,609

BJ hTERT+ SV40 Large T+ RasG12V 15,493

See all...

AA Sequence

MQKSEGSGGTQLKNRATGNYDQRTSSSTQLKHRNAVQGSKSSLSTSSPESARKLHPRPSDKLNPKTINPF      1 - 70
GEQSRVPSAFAAIYSKGGIPCRLVHGSVKHRLQWECPPESLSFDPLLITLAEGLRETKHPYTFVSKEGFR     71 - 140
ELLLVKGAPEKAIPLLPRLIPVLKAALVHSDDEVFERGLNALVQLSVVVGPSLNDHLKHLLTSLSKRLMD    141 - 210
KKFKEPITSALQKLEQHGGSGSLSIIKSKIPTYCSICC                                    211 - 248
//

Text Mined References (8)

Summary
Details

	PMID	Year	Title

Tdark PACRG-like protein Add to cart View Collections Empty Collection