Property Summary

NCBI Gene PubMed Count 32
PubMed Score 171.50
PubTator Score 27.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Synonym

Accession Q96M98 E1P5B5 Q6IMB8 Q8IZM1 Q8NHP5 Q9H1V9
Symbols GLUP
PARK2CRG
HAK005771

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (25)

PMID Text
23861666 Mapping of the PARK2 and PACRG gene regulatory region with 96 SNPs, with a resolution of 1 SNP per 1 Kb for PARK2 gene regulatory region in a North Indian population, showed an involvement of 11 SNPs in determining the susceptibility towards leprosy.
23125027 PARK2 and PACRG are commonly downregulated in clear-cell renal cell carcinoma and are associated with aggressive disease and poor clinical outcome.
23052943 conducted high-density association mapping of PARK2/PACRG SNPs with leprosy and identified 69 SNPs significantly associated with leprosy in 198 single-case Vietnamese leprosy families
22652456 Elevated levels of PACRG result in increased neuronal autophagy.
22009144 single nucleotide polymorphisms of PARK2 with leprosy susceptibility in Chinese population
21816242 the association of polymorphisms rs9356058 and rs1040079 in gene PARK2/PACRG with leprosy
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20012177 PINK1, Omi/HtrA2 and parkin participate at different levels in mitochondrial quality control, converging through some overlapping and some distinct steps to maintain a common phenotype of healthy mitochondrial networks [REVIEW]
19723394 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19268936 Mutation of PACRG was not identified as a cause of male infertility, but variation in the promoter was demonstrated to be a risk factor associated with azoospermia.
19268936 Observational study of gene-disease association. (HuGE Navigator)
19196541 Thw results of this study suggested that point mutations in PACRG are not a common cause of EO-PD but haploinsufficiency for PACRG may be associated with disease.
19196541 Observational study of gene-disease association. (HuGE Navigator)
17722288 The observed features of genotypic distribution by PACRG marker point to the influence of the considered marker on the incidence of tuberculosis.
17590346 PACRG is regulated by the ubiquitin-proteasomal system and may play a role in the pathogenesis of Parkinson's disease.
16391553 Suspected association of SNP's with leprosy is not borne out in Indian population.
16391553 Observational study of gene-disease association. (HuGE Navigator)
16287063 candidate tumor suppressor genes PARK2 and PACRG are epigenetically regulated in human leukemia, suggesting that abnormal methylation and regulation of PARK2 and PACRG may play a role in the pathogenesis and development of this hematological neoplasm
15925106 Observational study of gene-disease association. (HuGE Navigator)
15925106 mutation of PACRG plays little or no role in the development of early-onset parkinsonism
14737177 Observational study of gene-disease association. (HuGE Navigator)
14737177 Variants in the regulatory region shared by PARK2 and PACRG therefore act as common risk factors for leprosy
14532270 Glup/PACRG forms a large molecular chaperone complex, suppresses cell death induced by accumulation of unfolded Pael receptor, facilitates the formation of Pael-R inclusions,and is a component of Lewy bodies in Parkinson's disease
12547187 PACRG is linked to parkin via a bi-directional promoter

AA Sequence

MVAEKETLSLNKCPDKMPKRTKLLAQQPLPVHQPHSLVSEGFTVKAMMKNSVVRGPPAAGAFKERPTKPT      1 - 70
AFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLCEMTFPYEFFARQGIHDMLEHGGN     71 - 140
KILPVLPQLIIPIKNALNLRNRQVICVTLKVLQHLVVSAEMVGKALVPYYRQILPVLNIFKNMNGSYSLP    141 - 210
RLECSGAIMARCNLDHLGSSDPPTSASQVAEIIVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGENAF    211 - 280
INIKYVVPTYESCLLN                                                          281 - 296
//

Text Mined References (32)

PMID Year Title
23861666 2013 Mapping of PARK2 and PACRG overlapping regulatory region reveals LD structure and functional variants in association with leprosy in unrelated indian population groups.
23125027 2013 PARK2 and PACRG are commonly downregulated in clear-cell renal cell carcinoma and are associated with aggressive disease and poor clinical outcome.
23052943 2013 Linkage disequilibrium pattern and age-at-diagnosis are critical for replicating genetic associations across ethnic groups in leprosy.
22652456 2012 Parkin co-regulated gene is involved in aggresome formation and autophagy in response to proteasomal impairment.
22009144 2012 Association study of the single nucleotide polymorphisms of PARK2 and PACRG with leprosy susceptibility in Chinese population.
21816242 Leprosy epidemics during history increased protective allele frequency of PARK2/PACRG genes in the population of the Mljet Island, Croatia.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20012177 2009 Mitochondrial quality control: insights on how Parkinson's disease related genes PINK1, parkin, and Omi/HtrA2 interact to maintain mitochondrial homeostasis.
19723394 2009 Association of SLC11A1 with tuberculosis and interactions with NOS2A and TLR2 in African-Americans and Caucasians.
19268936 2010 Molecular analysis of the PArkin co-regulated gene and association with male infertility.
19196541 2009 Analysis of PArkin Co-Regulated Gene in a Taiwanese-ethnic Chinese cohort with early-onset Parkinson's disease.
17722288 2007 [Study of the polymorphic markers--the PARK2 and PACRG genes due to the incidence of pulmonary tuberculosis in two districts of the Republic of Tyva].
17590346 2007 Parkin Co-Regulated Gene (PACRG) is regulated by the ubiquitin-proteasomal system and is present in the pathological features of Parkinsonian diseases.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17068781 2007 Deletion of the parkin and PACRG gene promoter in early-onset parkinsonism.
16973374 2006 Genetic predisposition to leprosy: A major gene reveals novel pathways of immunity to Mycobacterium leprae.
16391553 2006 Association study of major risk single nucleotide polymorphisms in the common regulatory region of PARK2 and PACRG genes with leprosy in an Indian population.
16287063 2006 Abnormal methylation of the common PARK2 and PACRG promoter is associated with downregulation of gene expression in acute lymphoblastic leukemia and chronic myeloid leukemia.
15925106 2005 Genetic analysis of parkin co-regulated gene (PACRG) in patients with early-onset parkinsonism.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15301585 2004 Linkage of leprosy susceptibility to Parkinson's disease genes.
14743368 2004 It's a double knock-out! The quaking mouse is a spontaneous deletion of parkin and parkin co-regulated gene (PACRG).
14737177 2004 Susceptibility to leprosy is associated with PARK2 and PACRG.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14532270 2003 A product of the human gene adjacent to parkin is a component of Lewy bodies and suppresses Pael receptor-induced cell death.
12577057 2003 Chromosome 6q25 is linked to susceptibility to leprosy in a Vietnamese population.
12547187 2003 Identification of a novel gene linked to parkin via a bi-directional promoter.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.