Property Summary

NCBI Gene PubMed Count 29
PubMed Score 8.32
PubTator Score 9.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count
IGA Glomerulonephritis 454

Expression

 GWAS Trait (1)

Gene RIF (7)

PMID Text
26005159 The PABPC4 rs4660293 SNP is associated with serum lipid levels.
23300856 although function of PABPN1 may be compensated by nuclear translocation of PABP4 and perhaps by increase the cytoplasmic abundance of PABP5, these were not sufficient to prevent apoptosis of cells. PABPN1 may have an anti apoptotic role in mammalian cells
23125841 Tandem affinity purification and mass spectrometry analysis identify cytoplasmic poly(A) binding protein 4 (PABPC4), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22884093 PABPC4 is highly expressed in human colorectal cancer.
21940797 Nuclear relocalisation of cytoplasmic poly(A)-binding proteins PABP1 and PABP4 in response to UV irradiation reveals mRNA-dependent export
21646427 RNA binding masks nuclear import signals within the cytoplasmic poly(A) binding protein RNA recognition motifs, thereby ensuring ef fi cient cytoplasmic retention of this protein in normal cells
19956697 Tandem affinity purification and mass spectrometry analysis identify cytoplasmic poly(A) binding protein 4 (PABPC4), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells

AA Sequence

MNAAASSYPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALD      1 - 70
TMNFDVIKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGY     71 - 140
AFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEEVDDESLKEL    141 - 210
FSQFGKTLSVKVMRDPNGKSKGFGFVSYEKHEDANKAVEEMNGKEISGKIIFVGRAQKKVERQAELKRKF    211 - 280
EQLKQERISRYQGVNLYIKNLDDTIDDEKLRKEFSPFGSITSAKVMLEDGRSKGFGFVCFSSPEEATKAV    281 - 350
TEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQAQGRP    351 - 420
PYYTPNQLAQMRPNPRWQQGGRPQGFQGMPSAIRQSGPRPTLRHLAPTGSECPDRLAMDFGGAGAAQQGL    421 - 490
TDSCQSGGVPTAVQNLAPRAAVAAAAPRAVAPYKYASSVRSPHPAIQPLQAPQPAVHVQGQEPLTASMLA    491 - 560
AAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHHAKK    561 - 630
EAAQKVGAVAAATS                                                            631 - 644
//

Text Mined References (37)

PMID Year Title
26005159 2015 Gender-specific association between the cytoplasmic poly(A) binding protein 4 rs4660293 single nucleotide polymorphism and serum lipid levels.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23300856 2012 Depletion of nuclear poly(A) binding protein PABPN1 produces a compensatory response by cytoplasmic PABP4 and PABP5 in cultured human cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22884093 2012 Cytoplasmic poly(A) binding protein 4 is highly expressed in human colorectal cancer and correlates with better prognosis.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21940797 2011 Nuclear relocalisation of cytoplasmic poly(A)-binding proteins PABP1 and PABP4 in response to UV irradiation reveals mRNA-dependent export of metazoan PABPs.
21646427 2011 Importin alpha-mediated nuclear import of cytoplasmic poly(A) binding protein occurs as a direct consequence of cytoplasmic mRNA depletion.
21300955 2011 Meta-analysis of genome-wide association studies in >80 000 subjects identifies multiple loci for C-reactive protein levels.
21269460 2011 Initial characterization of the human central proteome.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17289661 2007 Molecular composition of IMP1 ribonucleoprotein granules.
17267499 2007 NFX1-123 and poly(A) binding proteins synergistically augment activation of telomerase in human papillomavirus type 16 E6-expressing cells.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15782174 2004 Identifying and quantifying in vivo methylation sites by heavy methyl SILAC.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383276 2004 A protein interaction network links GIT1, an enhancer of huntingtin aggregation, to Huntington's disease.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15231747 2004 A protein interaction framework for human mRNA degradation.
15161933 2004 Comprehensive proteomic analysis of interphase and mitotic 14-3-3-binding proteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14559993 2003 Regulation of alternative splicing by SRrp86 and its interacting proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11369516 2001 Inhibition of protein synthesis by the T cell receptor-inducible human TDAG51 gene product.
10543404 1999 Chromosomal localization of three human poly(A)-binding protein genes and four related pseudogenes.
10358005 1999 The eukaryotic polypeptide chain releasing factor (eRF3/GSPT) carrying the translation termination signal to the 3'-Poly(A) tail of mRNA. Direct association of erf3/GSPT with polyadenylate-binding protein.
9030741 1997 Identification and structure of activated-platelet protein-1, a protein with RNA-binding domain motifs that is expressed by activated platelets.
8524242 1995 iPABP, an inducible poly(A)-binding protein detected in activated human T cells.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.