Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.64
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Male infertility 170 3.773 1.9

Expression

  Differential Expression (10)

Disease log2 FC p
oligodendroglioma 1.300 4.1e-02
osteosarcoma 1.052 5.1e-03
astrocytoma 1.400 4.3e-03
Duchenne muscular dystrophy 1.203 3.2e-07
acute quadriplegic myopathy 1.196 7.4e-05
lung cancer -3.000 4.8e-02
lung adenocarcinoma 1.800 1.0e-10
spina bifida -1.001 3.5e-02
Pick disease 1.200 7.9e-06
ovarian cancer 1.800 2.5e-05

Synonym

Accession Q9H361 Q8NHV0 Q9H086 PABP-3
Symbols PABP3
tPABP
PABPL3

Gene

PDB

2D9P   4IVE  

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (3)

PMID Text
19956697 HIV-1 PR-induced PABP cleavage is involved in the inhibition of poly(A)-dependent translation. However, PABP cleavage has little impact on the translation of polyadenylated encephalomyocarditis virus internal ribosome entry site-containing mRNAs
19460752 Knockdown of poly(A) binding protein, cytoplasmic 3 (PABPC3) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
11328870 molecular cloning and expression in testis

AA Sequence

MNPSTPSYPTASLYVGDLHPDVTEAMLYEKFSPAGPILSIRICRDLITSGSSNYAYVNFQHTKDAEHALD      1 - 70
TMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFVKNLDKSINNKALYDTVSAFGNILSCNVVCDENGSKGY     71 - 140
GFVHFETHEAAERAIKKMNGMLLNGRKVFVGQFKSRKEREAELGARAKEFPNVYIKNFGEDMDDERLKDL    141 - 210
FGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRTF    211 - 280
EQMKQDRITRYQVVNLYVKNLDDGIDDERLRKAFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAV    281 - 350
TEMNGRIVATKPLYVALAQRKEERQAYLTNEYMQRMASVRAVPNQRAPPSGYFMTAVPQTQNHAAYYPPS    351 - 420
QIARLRPSPRWTAQGARPHPFQNKPSAIRPGAPRVPFSTMRPASSQVPRVMSTQRVANTSTQTVGPRPAA    421 - 490
AAAAAATPAVRTVPRYKYAAGVRNPQQHRNAQPQVTMQQLAVHVQGQETLTASRLASAPPQKQKQMLGER    491 - 560
LFPLIQAMHPTLAGKITGMLLEIDNSELLYMLESPESLRSKVDEAVAVLQAHQAKEATQKAVNSATGVPT    561 - 630
V//

Text Mined References (10)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16201836 2005 Emergence of young human genes after a burst of retroposition in primates.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11328870 2001 Human testis expresses a specific poly(A)-binding protein.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
10543404 1999 Chromosomal localization of three human poly(A)-binding protein genes and four related pseudogenes.
10358005 1999 The eukaryotic polypeptide chain releasing factor (eRF3/GSPT) carrying the translation termination signal to the 3'-Poly(A) tail of mRNA. Direct association of erf3/GSPT with polyadenylate-binding protein.
8432538 1993 Localization of the human poly(A)-binding protein gene (PAB1) to chromosomal regions 3q22-q25, 12q13-q14, and 13q12-q13 by in situ hybridization.