Property Summary

NCBI Gene PubMed Count 12
PubMed Score 17.31
PubTator Score 6.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma 1.700 2.3e-05
Astrocytoma, Pilocytic 1.500 3.2e-06
atypical teratoid / rhabdoid tumor 2.000 8.5e-06
ductal carcinoma in situ 1.300 4.7e-02
fibroadenoma 1.200 2.5e-02
glioblastoma 2.100 1.4e-06
invasive ductal carcinoma 2.000 8.4e-03
lung adenocarcinoma 1.300 2.6e-05
medulloblastoma 1.200 5.8e-03
osteosarcoma -1.428 4.4e-02
ovarian cancer 1.400 8.3e-05
pancreatic ductal adenocarcinoma liver m... 1.630 9.8e-04
primitive neuroectodermal tumor 1.700 3.2e-04
subependymal giant cell astrocytoma 2.101 2.3e-02
tuberculosis 1.600 1.3e-08

Gene RIF (4)

AA Sequence

MNASGSGYPLASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDVATRRSLGYAYINFQQPADAERALD      1 - 70
TMNFEMLKGQPIRIMWSQRDPGLRKSGVGNIFIKNLEDSIDNKALYDTFSTFGNILSCKVACDEHGSRGF     71 - 140
GFVHFETHEAAQQAINTMNGMLLNDRKVFVGHFKSRREREAELGARALEFTNIYVKNLPVDVDEQGLQDL    141 - 210
FSQFGKMLSVKVMRDNSGHSRCFGFVNFEKHEEAQKAVVHMNGKEVSGRLLYAGRAQKRVERQNELKRRF    211 - 280
EQMKQDRLRRYQGVNLYVKNLDDSIDDDKLRKEFSPYGVITSAKVMTEGGHSKGFGFVCFSSPEEATKAV    281 - 350
TEMNGRIVGTKPLYVALAQRKEERKAILTNQYMQRLSTMRTLSNPLLGSFQQPSSYFLPAMPQPPAQAAY    351 - 420
YGCGPVTPTQPAPRWTSQPPRPSCASMVRPPVVPRRPPAHISSVRQASTQVPRTVPHTQRVANIGTQTTG    421 - 490
PSGVGCCTPGRPLLPCKCSSAAHSTYRVQEPAVHIPGQEPLTASMLAAAPLHEQKQMIGERLYPLIHDVH    491 - 560
TQLAGKITGMLLEIDNSELLLMLESPESLHAKIDEAVAVLQAHQAMEQPKAYMH                    561 - 614
//

Text Mined References (12)

PMID Year Title