Property Summary

NCBI Gene PubMed Count 142
PubMed Score 365.16
PubTator Score 226.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
acute quadriplegic myopathy 1.615 1.0e-05
astrocytoma 1.500 4.9e-03
Down syndrome 1.100 4.8e-04
Duchenne muscular dystrophy 1.422 2.9e-07
juvenile dermatomyositis 1.077 4.6e-08
lung cancer -3.100 4.4e-02
ovarian cancer 2.700 1.3e-06
spina bifida -1.094 2.6e-02

Protein-protein Interaction (1)

PDB (27)

Gene RIF (71)

AA Sequence

MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALD      1 - 70
TMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGY     71 - 140
GFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDL    141 - 210
FGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKF    211 - 280
EQMKQDRITRYQGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAV    281 - 350
TEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRA    351 - 420
AYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTM    421 - 490
GPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQKQ    491 - 560
MLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVNSA    561 - 630
TGVPTV                                                                    631 - 636
//

Text Mined References (160)

PMID Year Title