Property Summary

NCBI Gene PubMed Count 131
PubMed Score 344.14
PubTator Score 226.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.500 4.9e-03
Duchenne muscular dystrophy 1.422 2.9e-07
juvenile dermatomyositis 1.077 4.6e-08
acute quadriplegic myopathy 1.615 1.0e-05
lung cancer -3.100 4.4e-02
spina bifida -1.094 2.6e-02
ovarian cancer 2.700 1.3e-06
Down syndrome 1.100 4.8e-04

Protein-protein Interaction (167)

CNOT1   POM121C   EIF3F   LSM1   EIF3D   EIF3H   NUPL2   CNOT3   EIF3G   EIF3J   PARN   CNOT4   EIF2S1   RPLP1   RPLP2   RPLP0   EIF4E   RPS17   RPSA   HSPA1B   RPS2   RPL35A   RPL7   RPL17   EIF2S2   RPS4Y1   RPS3   EIF4B   RPS12   RPL13   RPL10   RPL12   RPL9   RPL22   RPL4   RPS19   RPL3   RPL13A   EIF2S3   RPS27   RPL35   RPL27A   RPL5   RPL21   RPL28   RPS9   RPS5   RPS10   EIF1AX   RPL29   RPL34   RPL14   NUP98   EIF3B   EIF3E   EIF4A1   RPS20   RPS3A   RPL26   RPL15   RPL27   RPL37A   RPL37   RPS7   RPS8   RPS15A   RPS16   RPS14   RPS23   RPS18   RPS29   RPS13   RPS11   LSM6   RPL7A   RPS4X   RPL23A   RPS6   RPL23   RPS15   RPS24   RPS25   RPS26   RPS28   FAU   RPL30   RPL39   RPL31   RPL10A   RPL32   RPL11   RPL8   RPL41   RPS27A   UBA52   RPL38   RPS21   RPL24   RPL36A   RPL19   RPL18A   RPL6   EIF4G1   EXOSC9   RPL18   EIF3I   EXOSC2   HNRNPD   EIF3A   EIF4A2   EXOSC7   EIF4H   RNPS1   PAN2   PAN3   EXOSC6   NUP188   TTC37   EIF3M   NUP54   PATL1   SMG6   ALYREF   SRRM1   GSPT2   NUP93   SMG8   NUP35   NUP210   NUP133   CNOT9   NUP205   MAGOHB   EXOSC8   SEH1L   POM121   CNOT6L   SMG1   EIF3C   NDC1   NUP58   NUP85   UPF3B   WDR61   NXF2B   PAIP1   SMG9   UPF3A   CNOT10   UPF2   EXOSC4   EXOSC5   EXOSC3   CNOT2   EIF3K   NXF1   LSM7   CNOT11   CNOT6   SMG5   DIS3   EXOSC1   RPL36   HBS1L   LSM5   LSM4   RBM8A  

MLP Assay (9)

AID Type Active / Inconclusive / Inactive Description
2014 confirmatory 2985 / 2226 / 285864 uHTS fluorescence polarization assay for the identification of translation initiation inhibitors (PABP)
2030 summary 0 / 0 / 0 Summary assay for the identification of translation initiation inhibitors (PABP)
435018 confirmatory 24 / 0 / 61 SAR analysis for the identification of translation initiation inhibitors (PABP)
449751 confirmatory 2 / 0 / 0 SAR analysis for the identification of translation initiation inhibitors (PABP) via an Electrophoretic Mobility Shift Dose Response Assay
449752 screening 4 / 0 / 21 SAR analysis for the identification of translation initiation inhibitors (PABP) via an Electrophoretic Mobility Shift Assay
588489 screening 1308 / 0 / 358213 uHTS identification of microRNA-mediated mRNA deadenylation inhibitors by fluoresence polarization assay
588500 summary 0 / 0 / 0 Summary assay for small molecule inhibitors of microRNA-mediated mRNA deadenylation
602259 confirmatory 11 / 0 / 1175 Dose-response confirmation of microRNA-mediated mRNA deadenylation inhibitors by fluoresence polarization assay
602260 confirmatory 0 / 0 / 1186 Dose-response secondary confirmation of microRNA-mediated mRNA deadenylation inhibitors by fluoresence polarization assay using Cy5 labeled peptide

Gene RIF (66)

PMID Text
26912148 BTG2 stimulates mRNA deadenylation via CAF1 activation through interaction with PABPC1. Interaction of BTG2 with the first RRM domain of PABPC1 is required for BTG2 to control cell proliferation.
26188282 PABPC1 interacts with AGO2 and is responsible for the microRNA mediated gene silencing in high grade hepatocellular carcinoma.
26176602 PABPC1 is a novel co-regulator of the AR
26097561 PABPC1 is upregulated in gastric carcinoma tissues, and high PABPC1 expression predicts poor survival. PABPC1 regulates proliferation and transformation of gastric cancer cells in vitro and in vivo. PABPC1 knockdown induces apoptosis.
25503397 Poly(A) binding protein 1 enhances cap-independent translation initiation of neurovirulence factor from avian herpesvirus
25496916 Poly(A) binding protein, cytoplasmic 1 (PABPC1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
25111021 This study highlights PABP-1 as a protein that is important to the pathology of ALS and indicates that the proteomic profile of TDP-43 inclusions in ALS may differ depending on the causative genetic mutation.
25065644 Metastatic duodenal cancer cells do not tolerate intracellular PABP1 accumulation and are thus exported into the extracellular milieu by the exosome-mediated pathway. In addition, PABP1 has a potential use as a biomarker for metastatic duodenal cancer.
24336168 PABPC1 is mislocalized in spinal cord motor neurons in amyotrophic lateral sclerosis.
23966414 These results suggest that production of the NSs protein during rift valley fever virus infection leads to sequestration of PABP1 in the nuclear speckles, creating a state within the cell that favors viral protein production.
23711718 Study shows that PABP specifically regulates iNOS mRNA stability in human DLD-1 cells by binding to different sites in the 50- and 30-UTR of the iNOS mRNA. .
23125841 Poly(A) binding protein, cytoplasmic 1 (PABPC1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
23077296 These data indicate that PABPC1 is an important cellular target of human herpesvirus 8 ORF57 to directly upregulate polyadenylated nuclear RNA accumulation during viral lytic infection.
23041282 Data show that eIF4G interacts with the RRM2 domain of polyadenylate-binding protein-1 (PABP).
22907758 data suggest that PABPC1 is essential for the formation of L1 RNA-protein complexes and may play a role in L1 RNP translocation in the host cell
22837200 EMCV 3C proteinase mediates site-specific PABP cleavage and demonstrate that PABP cleavage by 3C regulates EMCV replication
22431630 This finding demonstrates that viruses can increase host translation initiation factor concentration to foster their replication and defines a unique mechanism whereby control of PABP abundance regulates eIF4F assembly.
22174317 Poly(A) binding protein, cytoplasmic 1 (PABPC1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
22022268 study presents evidence that the function of KSHV polyadenylated nuclear (PAN) RNA is to bind poly(A) binding protein, which normally binds poly(A) tails of mRNAs in the cytoplasm but is re-localized into the nucleus during lytic KSHV infection
22004688 A direct link between PABP1 modification status and the formation of distinct mRNP (messenger ribonucleoprotein) complexes that regulate mRNA fate in the cytoplasm.
21989405 a role for PABPC1 and associated translation initiation factors in nonsense-mediated mRNA decay (NMD) evasion of AUG-proximal nonsense-mutated transcripts
21940797 Nuclear relocalisation of cytoplasmic poly(A)-binding proteins PABP1 and PABP4 in response to UV irradiation reveals mRNA-dependent export
21883093 The present study has characterized DDX3 as a pivotal SG-nucleating factor and illustrates co-ordinative roles for DDX3, eIF4E and PABP1 in integrating environmental stress with translational regulation.
21539808 in the absence of PABP, the glycolytic enzyme GAPDH translocated to the cell nucleus and activated the GAPDH mediated apoptotic pathway by enhancing acetylation and serine 46 phosphorylation of p53.
21521633 these results suggest that depletion of PABP prevents protein synthesis and consequently leads to cell death through apoptosis.
21098120 LARP4 activity is integrated with other PAM2 protein activities by PABP as part of mRNA homeostasis.
21063388 These findings reveal that despite species-specific differences in the relative strength of the PABPC1-binding sites, the interaction between GW182 proteins and PABPC1 is critical for miRNA-mediated silencing in animal cells.
20980505 Cytoplasmic PABP accumulation is translationally controlled in human cytomegalovirus-infected cells.
20595394 Tob interactions with Caf1 and a C-terminal domain of PABPC1
20573819 PABP relocalization in infection was found to be independent of the viral protein ICP27.
20544796 Data show that in addition to PP2Ac, alpha4 interacts with EDD and PABP, suggesting its involvement in multiple steps in the mTOR pathway that leads to translation initiation and cell-cycle progression.
20418951 crystal structures of the MLLE domain from PABPC1 in complex with the two PAM2 regions of eRF3
20181956 Structural basis of binding of P-body-associated proteins GW182 and ataxin-2 by the Mlle domain of poly(A)-binding protein.(
20098421 The authors show that a conserved motif in the human GW182 paralog TNRC6C interacts with the C-terminal domain of polyadenylate binding protein 1 (PABC) and present the crystal structure of the complex.
20096703 The side chain of the invariant MLLE residue K580 of poly(A)-binding protein forms hydrogen bonds with the backbone of PAM2 residues 5 and 7.
20009508 The cytoplasmic poly (A)-binding protein (PABP) plays a crucial role in regulating both translation and stability of eukaryotic mRNA.
19956697 HIV- 1 protease inhibits Cap- and poly(A)-dependent translation upon eIF4GI and PABP cleavage
19956697 Poly(A) binding protein, cytoplasmic 1 (PABPC1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
19934229 Poly(A)-binding protein modulates mRNA susceptibility to cap-dependent miRNA-mediated repression.
19369421 Data show that reduced levels of eIF4B, eIF4H, or polyA-binding protein, also trigger SG formation.
19193790 Bunyamwera virus triggers nuclear retention of PABP in mammalian cells.
18957126 The authors demonstrate that inhibition of HIV expression by Sam68DeltaC is correlated with a loss of PABP1 binding with no attendant change in polyadenosine tail length of the affected RNAs.
18799579 We show here that PABP-C1 evicted from eIF4G by NSP3 accumulates in the nucleus of rotavirus-infected cells.
18642007 Basophilic inclusions from patients with adult-onset atypical motor neuron disease were distinctly labeled with the antibodies against poly(A)-binding protein 1, T cell intracellular antigen 1, and ribosomal protein S6.
18632855 poly(A)-binding protein cleavage by poliovirus 3C proteinase inhibits viral internal ribosome entry site-mediated translation
18467502 Findings suggest several levels of functional antagonism between TTP and PABP1 that have implications for regulation of unstable mRNAs like TNF.
18321554 The results further elucidate complex mechanisms where multiple inherent PABP conformations and protein and RNA interactions both serve to differentially regulate PABP cleavage by 3CD, 3C(pro) and 2A(pro).
18305028 RUBVgp2 capsid protein inhibits genetic translation by sequestration of poly(a)-binding protein
18230761 Nonsense-mediated decay-sensitive mRNA can be stabilized by tethering the cytoplasmic poly(A) binding protein 1, PABPC1, at a premature termination codon-proximal position.
17785442 Data show that TOB enhances mRNA deadenylation in vivo, and that interaction with PABPC1 is necessary for TOB's deadenylation-enhancing effect.
17595167 the poly(A) nuclease interacts with the C-terminal domain of polyadenylate-binding protein domain from poly(A)-binding protein
17212783 We have further characterized the interaction between PABP and IMP1 with the 3' end of the adenine-rich autoregulatory sequence
17150895 Structural study of the A-rich repeats in the 5'-untranslated region of PABP.
16782705 poly(A)-binding protein 1 (PABP) as a novel BRCA1-interacting protein.
16716377 PABP interacts with HHV-8 K10/10.1 protein in infected primary effusion lymphoma (PEL) cell lines.
16703665 Poly(A) binding protein, cytoplasmic 1 (PABPC1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
16594896 Poly(A) binding protein, cytoplasmic 1 (PABPC1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
16465428 In esophageal cancer, reduced expression of PABPC1 was correlated with local tumor progression and poor prognosis after surgery.
16332685 a novel signaling pathway involving MKK-2 and ERK1/2 may down-regulate the activity of PABP and eIF4E by controlling their phosphorylation and compensates for the effect of excess cellular PABP
15831480 PABP1 associates with paxillin in order to be efficiently transported from the nucleus to the cytoplasm; this event is necessary for cells to remodel their focal adhesions during cell migration.
14739600 targeted degradation of PABP contributes to translation inhibition in apoptotic cells
12565831 PABP1 is a potential substrate in MAPKAP kinase 2-induced mRNA stabilization.
11997512 Paip1 interacts with poly(A) binding protein through two independent binding motifs.
11850402 Methylated in vivo by CARM1. Methylated region is mapped.
8657127 Poly(A) binding protein, cytoplasmic 1 (PABPC1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
8057425 Poly(A) binding protein, cytoplasmic 1 (PABPC1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS

AA Sequence

MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALD      1 - 70
TMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGY     71 - 140
GFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDL    141 - 210
FGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKF    211 - 280
EQMKQDRITRYQGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAV    281 - 350
TEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRA    351 - 420
AYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTM    421 - 490
GPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQKQ    491 - 560
MLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVNSA    561 - 630
TGVPTV                                                                    631 - 636
//

Text Mined References (148)

PMID Year Title
26912148 2016 BTG2 bridges PABPC1 RNA-binding domains and CAF1 deadenylase to control cell proliferation.
26735137 2016 Characterization of RyDEN (C19orf66) as an Interferon-Stimulated Cellular Inhibitor against Dengue Virus Replication.
26188282 2015 PABPC1 interacts with AGO2 and is responsible for the microRNA mediated gene silencing in high grade hepatocellular carcinoma.
26176602 2015 Poly (A) Binding Protein Cytoplasmic 1 Is a Novel Co-Regulator of the Androgen Receptor.
26097561 2015 PABPC1 exerts carcinogenesis in gastric carcinoma by targeting miR-34c.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25503397 2014 Poly(A) binding protein 1 enhances cap-independent translation initiation of neurovirulence factor from avian herpesvirus.
25480299 2014 Uridylation by TUT4 and TUT7 marks mRNA for degradation.
25111021 2014 Poly-A binding protein-1 localization to a subset of TDP-43 inclusions in amyotrophic lateral sclerosis occurs more frequently in patients harboring an expansion in C9orf72.
25065644 2014 Exosome-mediated extracellular release of polyadenylate-binding protein 1 in human metastatic duodenal cancer cells.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24532714 2014 Proteomic analysis of cap-dependent translation identifies LARP1 as a key regulator of 5'TOP mRNA translation.
24396066 2014 Control of Paip1-eukayrotic translation initiation factor 3 interaction by amino acids through S6 kinase.
24336168 2014 Therapeutic modulation of eIF2? phosphorylation rescues TDP-43 toxicity in amyotrophic lateral sclerosis disease models.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23966414 2013 Nuclear relocalization of polyadenylate binding protein during rift valley fever virus infection involves expression of the NSs gene.
23770097 2013 Insulin receptor substrate-1 (IRS-1) forms a ribonucleoprotein complex associated with polysomes.
23711718 2013 Post-transcriptional regulation of the human inducible nitric oxide synthase (iNOS) expression by the cytosolic poly(A)-binding protein (PABP).
23535375 2013 Interleukin-27 treated human macrophages induce the expression of novel microRNAs which may mediate anti-viral properties.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23340509 2013 Phosphorylation at intrinsically disordered regions of PAM2 motif-containing proteins modulates their interactions with PABPC1 and influences mRNA fate.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23077296 2013 Interplay between polyadenylate-binding protein 1 and Kaposi's sarcoma-associated herpesvirus ORF57 in accumulation of polyadenylated nuclear RNA, a viral long noncoding RNA.
23041282 2012 Interdomain allostery promotes assembly of the poly(A) mRNA complex with PABP and eIF4G.
22907758 2012 Poly(A) binding protein C1 is essential for efficient L1 retrotransposition and affects L1 RNP formation.
22872150 2012 DEAD-box protein DDX3 associates with eIF4F to promote translation of selected mRNAs.
22837200 2012 Site-specific cleavage of the host poly(A) binding protein by the encephalomyocarditis virus 3C proteinase stimulates viral replication.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22431630 2012 Poly(A) binding protein abundance regulates eukaryotic translation initiation factor 4F assembly in human cytomegalovirus-infected cells.
22022268 2011 A viral nuclear noncoding RNA binds re-localized poly(A) binding protein and is required for late KSHV gene expression.
22004688 2012 The multifunctional poly(A)-binding protein (PABP) 1 is subject to extensive dynamic post-translational modification, which molecular modelling suggests plays an important role in co-ordinating its activities.
21989405 2012 Interaction of PABPC1 with the translation initiation complex is critical to the NMD resistance of AUG-proximal nonsense mutations.
21984414 2012 The RNA recognition motif protein RBM11 is a novel tissue-specific splicing regulator.
21981923 2011 GW182 proteins directly recruit cytoplasmic deadenylase complexes to miRNA targets.
21940797 2011 Nuclear relocalisation of cytoplasmic poly(A)-binding proteins PABP1 and PABP4 in response to UV irradiation reveals mRNA-dependent export of metazoan PABPs.
21883093 2012 Critical roles of RNA helicase DDX3 and its interactions with eIF4E/PABP1 in stress granule assembly and stress response.
21700224 2011 Human senataxin resolves RNA/DNA hybrids formed at transcriptional pause sites to promote Xrn2-dependent termination.
21539808 2011 In the absence of cellular poly (A) binding protein, the glycolytic enzyme GAPDH translocated to the cell nucleus and activated the GAPDH mediated apoptotic pathway by enhancing acetylation and serine 46 phosphorylation of p53.
21521633 2011 Depletion of cellular poly (A) binding protein prevents protein synthesis and leads to apoptosis in HeLa cells.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
21098120 2011 La-related protein 4 binds poly(A), interacts with the poly(A)-binding protein MLLE domain via a variant PAM2w motif, and can promote mRNA stability.
21063388 2010 Two PABPC1-binding sites in GW182 proteins promote miRNA-mediated gene silencing.
20980505 2011 Translational control of the abundance of cytoplasmic poly(A) binding protein in human cytomegalovirus-infected cells.
20696395 2010 Conserved beta-hairpin recognition by the GYF domains of Smy2 and GIGYF2 in mRNA surveillance and vesicular transport complexes.
20595394 2010 Quantitative characterization of Tob interactions provides the thermodynamic basis for translation termination-coupled deadenylase regulation.
20595389 2010 MAPKAP kinase 2 blocks tristetraprolin-directed mRNA decay by inhibiting CAF1 deadenylase recruitment.
20573819 2010 Poly(A)-binding protein 1 partially relocalizes to the nucleus during herpes simplex virus type 1 infection in an ICP27-independent manner and does not inhibit virus replication.
20573744 2010 A stimulatory role for the La-related protein 4B in translation.
20544796 2010 alpha4 phosphoprotein interacts with EDD E3 ubiquitin ligase and poly(A)-binding protein.
20430826 2010 The RNA binding protein Larp1 regulates cell division, apoptosis and cell migration.
20418951 2010 Molecular basis of eRF3 recognition by the MLLE domain of poly(A)-binding protein.
20221403 2010 Phosphorylation of human tristetraprolin in response to its interaction with the Cbl interacting protein CIN85.
20181956 2010 Structural basis of binding of P-body-associated proteins GW182 and ataxin-2 by the Mlle domain of poly(A)-binding protein.
20133758 2010 Human cytomegalovirus UL69 protein facilitates translation by associating with the mRNA cap-binding complex and excluding 4EBP1.
20102337 2010 Poly(A)-binding protein (PABP): a common viral target.
20098421 2010 Structural insights into the human GW182-PABC interaction in microRNA-mediated deadenylation.
20096703 2010 Molecular determinants of PAM2 recognition by the MLLE domain of poly(A)-binding protein.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20009508 Multiple levels of post-transcriptional control of expression of the poly (A)-binding protein.
19956697 2009 HIV- 1 protease inhibits Cap- and poly(A)-dependent translation upon eIF4GI and PABP cleavage.
19946888 2010 Defining the membrane proteome of NK cells.
19934229 2010 Poly(A)-binding protein modulates mRNA susceptibility to cap-dependent miRNA-mediated repression.
19716330 2009 Mammalian miRNA RISC recruits CAF1 and PABP to affect PABP-dependent deadenylation.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19515850 2009 Functional role for senataxin, defective in ataxia oculomotor apraxia type 2, in transcriptional regulation.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369421 2009 Uncoupling stress granule assembly and translation initiation inhibition.
19193790 2009 Bunyamwera orthobunyavirus S-segment untranslated regions mediate poly(A) tail-independent translation.
19029303 2009 Control of c-myc mRNA stability by IGF2BP1-associated cytoplasmic RNPs.
18957126 2008 Selective translational repression of HIV-1 RNA by Sam68DeltaC occurs by altering PABP1 binding to unspliced viral RNA.
18799579 2008 Nuclear localization of cytoplasmic poly(A)-binding protein upon rotavirus infection involves the interaction of NSP3 with eIF4G and RoXaN.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18642007 2008 Immunohistochemical identification of messenger RNA-related proteins in basophilic inclusions of adult-onset atypical motor neuron disease.
18632855 2008 Cleavage of poly(A)-binding protein by poliovirus 3C proteinase inhibits viral internal ribosome entry site-mediated translation.
18596238 2008 The DEAD-box RNA helicase DDX3 associates with export messenger ribonucleoproteins as well as tip-associated protein and participates in translational control.
18467502 2008 Inhibition of tristetraprolin deadenylation by poly(A) binding protein.
18447585 2008 A competition between stimulators and antagonists of Upf complex recruitment governs human nonsense-mediated mRNA decay.
18321554 2008 Modulation of enteroviral proteinase cleavage of poly(A)-binding protein (PABP) by conformation and PABP-associated factors.
18305028 2008 Rubella virus capsid protein interacts with poly(a)-binding protein and inhibits translation.
18230761 2008 Proximity of the poly(A)-binding protein to a premature termination codon inhibits mammalian nonsense-mediated mRNA decay.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17932509 2007 Proteomic and functional analysis of Argonaute-containing mRNA-protein complexes in human cells.
17785442 2007 Human TOB, an antiproliferative transcription factor, is a poly(A)-binding protein-dependent positive regulator of cytoplasmic mRNA deadenylation.
17595167 2007 Poly(A) nuclease interacts with the C-terminal domain of polyadenylate-binding protein domain from poly(A)-binding protein.
17392519 2007 Ataxin-2 interacts with the DEAD/H-box RNA helicase DDX6 and interferes with P-bodies and stress granules.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17289661 2007 Molecular composition of IMP1 ribonucleoprotein granules.
17267499 2007 NFX1-123 and poly(A) binding proteins synergistically augment activation of telomerase in human papillomavirus type 16 E6-expressing cells.
17220478 2007 Proteomics analysis of the interactome of N-myc downstream regulated gene 1 and its interactions with the androgen response program in prostate cancer cells.
17212783 2006 IMP1 interacts with poly(A)-binding protein (PABP) and the autoregulatory translational control element of PABP-mRNA through the KH III-IV domain.
17150895 2006 Crystallization of auto-regulatory A-rich repeats found in the 5'-UTR of human PABP mRNA.
16869712 2006 Gene expression analysis of zebrafish heart regeneration.
16804161 2006 Regulation of poly(A) binding protein function in translation: Characterization of the Paip2 homolog, Paip2B.
16782705 2006 BRCA1 interacts with poly(A)-binding protein: implication of BRCA1 in translation regulation.
16716377 2006 Expression of Kaposi's sarcoma-associated herpesvirus-encoded K10/10.1 protein in tissues and its interaction with poly(A)-binding protein.
16601676 2006 Poly(A) binding protein (PABP) homeostasis is mediated by the stability of its inhibitor, Paip2.
16556936 2006 Assembly of AUF1 with eIF4G-poly(A) binding protein complex suggests a translation function in AU-rich mRNA decay.
16465428 2006 Expression and prognostic roles of PABPC1 in esophageal cancer: correlation with tumor progression and postoperative survival.
16452507 2006 Binding of a novel SMG-1-Upf1-eRF1-eRF3 complex (SURF) to the exon junction complex triggers Upf1 phosphorylation and nonsense-mediated mRNA decay.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16356927 2005 The autoregulatory translational control element of poly(A)-binding protein mRNA forms a heteromeric ribonucleoprotein complex.
16332685 2006 Reduced stability of mitogen-activated protein kinase kinase-2 mRNA and phosphorylation of poly(A)-binding protein (PABP) in cells overexpressing PABP.
16126846 2005 Involvement of KSRP in the post-transcriptional regulation of human iNOS expression-complex interplay of KSRP with TTP and HuR.
15831480 2005 Interaction of paxillin with poly(A)-binding protein 1 and its role in focal adhesion turnover and cell migration.
15782174 2004 Identifying and quantifying in vivo methylation sites by heavy methyl SILAC.
15663938 2005 An integrative approach to gain insights into the cellular function of human ataxin-2.
15630022 2005 Mammalian poly(A)-binding protein is a eukaryotic translation initiation factor, which acts via multiple mechanisms.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15567442 2004 Proteomics of herpes simplex virus infected cell protein 27: association with translation initiation factors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15314026 2004 UNR, a new partner of poly(A)-binding protein, plays a key role in translationally coupled mRNA turnover mediated by the c-fos major coding-region determinant.
15121898 2004 The composition of Staufen-containing RNA granules from human cells indicates their role in the regulated transport and translation of messenger RNAs.
14739600 2004 Degradation of poly(A)-binding protein in apoptotic cells and linkage to translation regulation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14685257 2004 Structural basis of ligand recognition by PABC, a highly specific peptide-binding domain found in poly(A)-binding protein and a HECT ubiquitin ligase.
12844354 2003 Poly(A)-binding proteins: multifunctional scaffolds for the post-transcriptional control of gene expression.
12588972 2003 Transcript-selective translational silencing by gamma interferon is directed by a novel structural element in the ceruloplasmin mRNA 3' untranslated region.
12565831 2003 Affinity purification of ARE-binding proteins identifies polyA-binding protein 1 as a potential substrate in MK2-induced mRNA stabilization.
12489690 2002 Poly(A)-binding protein and eRF3 are associated in vivo in human and Xenopus cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12388589 2002 A receptor for activated C kinase is part of messenger ribonucleoprotein complexes associated with polyA-mRNAs in neurons.
12086624 2002 Recognition of eIF4G by rotavirus NSP3 reveals a basis for mRNA circularization.
11997512 2002 Paip1 interacts with poly(A) binding protein through two independent binding motifs.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11850402 2002 PABP1 identified as an arginine methyltransferase substrate using high-density protein arrays.
11704675 2002 Paxillin associates with poly(A)-binding protein 1 at the dense endoplasmic reticulum and the leading edge of migrating cells.
11438674 2001 Dual interactions of the translational repressor Paip2 with poly(A) binding protein.
11328870 2001 Human testis expresses a specific poly(A)-binding protein.
11287632 2001 Structure and function of the C-terminal PABC domain of human poly(A)-binding protein.
11274152 2001 Disruption of the interaction of mammalian protein synthesis eukaryotic initiation factor 4B with the poly(A)-binding protein by caspase- and viral protease-mediated cleavages.
11172725 2001 Translational repression by a novel partner of human poly(A) binding protein, Paip2.
11051545 2000 A mechanism for translationally coupled mRNA turnover: interaction between the poly(A) tail and a c-fos RNA coding determinant via a protein complex.
10543404 1999 Chromosomal localization of three human poly(A)-binding protein genes and four related pseudogenes.
10499800 1999 Recognition of polyadenylate RNA by the poly(A)-binding protein.
10373504 1999 An mRNA stability complex functions with poly(A)-binding protein to stabilize mRNA in vitro.
10358005 1999 The eukaryotic polypeptide chain releasing factor (eRF3/GSPT) carrying the translation termination signal to the 3'-Poly(A) tail of mRNA. Direct association of erf3/GSPT with polyadenylate-binding protein.
10205060 1999 Control of mRNA decay by heat shock-ubiquitin-proteasome pathway.
9880551 1999 The expression of poly(A)-binding protein gene is translationally regulated in a growth-dependent fashion through a 5'-terminal oligopyrimidine tract motif.
9857202 1998 A newly identified N-terminal amino acid sequence of human eIF4G binds poly(A)-binding protein and functions in poly(A)-dependent translation.
9582337 1998 The human poly(A)-binding protein 1 shuttles between the nucleus and the cytoplasm.
9548260 1998 Interaction of polyadenylate-binding protein with the eIF4G homologue PAIP enhances translation.
8657127 1996 Role of polyadenylation in nucleocytoplasmic transport of mRNA.
8057425 1994 Human immunodeficiency virus type 1 Rev is required in vivo for binding of poly(A)-binding protein to Rev-dependent RNAs.
7908267 1994 The mRNA poly(A)-binding protein: localization, abundance, and RNA-binding specificity.
2885805 1987 Human mRNA polyadenylate binding protein: evolutionary conservation of a nucleic acid binding motif.