Property Summary

NCBI Gene PubMed Count 63
PubMed Score 35.95
PubTator Score 65.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Protein-protein Interaction (1)

Gene RIF (38)

PMID Text
26436510 The combined determination of Ebp1 and p53 expression levels in cervical cancer patients could support the effective prediction of metastatic potential and patient prognosis.
26256794 EBP1 participates in the regulation of intestinal inflammation via mediating Akt signaling pathway.
26081906 Data highlight the tissue specificity function of EBP1 isoforms and show that only the oncogene p48 activates MHC II expression in human solid tumors, via STAT1 phosphorylation, in order to affect tumor progression by triggering specific immune response.
25917452 Our results suggest a novel function of Ebp1 as a binding protein and negative regulator of Anxa2. The functional association between Anxa2 and EBP1 may participate in regulating cancer cell proliferation and invasion, contributing to cancer progression.
25691158 Data suggest that inhibiting ErbB3-binding protein 1 Ebp1 phosphorylation may be an effective mechanism for inhibiting T-cell activation and proliferation.
25154617 P48Ebp1 acts as an oncoprotein.
24798454 Ebp1 functionality is independent from heat-shock-protein-regulated progression networks in prostate cancer.
24651434 Ebp1 p42 isoform regulates the proteasomal degradation of the p85 regulatory subunit of PI3K by recruiting a chaperone-E3 ligase complex HSP70/CHIP.
23828502 data suggest that Vpr may inhibit Ebp1 to stabilize p53, which in turn leads to G2 arrest and apoptosis in U87MG cells
23828502 HIV-1 Vpr downregulates proliferation-associated protein 2G4 (PA2G4) and upregulates p53 in glioblastoma U87MG cells
23707440 identified among endothelial antigens to which antibodies are produced during heart transplant rejection
23283744 Down-regulation of the ErbB3 binding protein 1 in human bladder cancer promotes tumor progression and cell proliferation.
23242156 The major effect of EBP1 on ErbB2 mRNA expression levels is at the transcriptional level.
23110497 Performed immunohistochemical analysis on 132 primary adenoid cystic carcinoma and adjacent non-cancerous tissues.The expression of EBP1 was significantly higher in non-cancerous adjacent tissues compared with corresponding cancer tissues.
22944692 HIV-1 Vpr downregulates proliferation-associated protein 2G4 (PA2G4) and upregulates p53 in glioblastoma U87MG cells
21965718 These studies suggest that one pathway of EBP1 down-regulation of AR levels may be lost in castration-resistant prostate cancer.
21930127 It was shown that high level of Ebp1 expression led to enhancee HDM2 phosphorylation by Akt and inhibited the self-ubiquitination of HDM2 by up-regulation of Akt activity.
21794029 the Ebp1 promoter localizes between -664 nt and the initiation site of the Ebp1 gene, +317-nt long sequence in the noncoding region is required for regulation of Ebp1 gene expression.
21145366 Ebp1 contributes to neuronal cell differentiation and growth factor specificity through the activation of protein kinase Cdelta acting as a crucial downstream effector of neurotrophin signaling.
21098709 Findings suggest that eBP1 p48 functions as an oncogene by promoting glioma tumorigenicity via interactions with HDM2 that contribute to p53 downregulation.
21085677 Data show that E2F is likely a central coordinator of multiple responses that culminate in regulation of EBP1 gene expression, and which may vary depending on cell type and context.
20379846 Ablation of EBP1 expression led to tamoxifen resistance in breast cancer.
20048076 our results reveal an EBP1-Foxa-AGR2 signaling circuit with functional significance in metastatic prostate cancer
19037095 hBre1 inhibits Ebp1's tumor suppressive activity through mediating its polyubiquitination and degradation.
18852121 These data support a role for EBP1 in the development of hormone-refractory prostate cancer.
18355957 These results suggest that EBP1, by down-regulating ErbB signal transduction, attentuates HRG-mediated growth of breast cancer cells.
17951246 B23 distinctively binds Ebp1 isoforms and regulates cell proliferation and survival through p42 and p48, respectively.
17768350 ErbB-3-binding protein 1 (Ebp1) is a member of the family of proliferation-associated 2G4 proteins (PA2G4s) and plays a role in cellular growth and differentiation.
17765895 The structure provides insights in how Ebp1 discriminates between its different interaction partners.
17641068 ErbB-3-binding protein-1 is an immunogenic protein with cancer-related immunoreactivity, capable of eliciting CD8-positive T cell-mediated responses in vivo and in vitro.
17316401 PKC-delta antagonizes apoptosis through phosphorylating Ebp1 and protects it from apoptotic degradation.
17295834 over-expression of Ebp1 interfered with virus production
16631606 Our results demonstrate that Ebp1 is a new dsRNA-binding protein that acts as a cellular inhibitor of eIF2alpha phosphorylation suggesting that it could be involved in protein translation control
16396631 Ebp1 is present in protein-ARE(bcl-2) RNA complexes. Ebp1 & nucleolin are present in the same bcl-2 mRNP complexes. Ebp1 decreases the rate of decay of beta-globin-ARE(bcl-2) transcripts. Ebp1 contributes to bcl-2 expression regulation in HL-60 cells.
15994225 Ebp1 suppresses androgen receptor-mediated gene transcription and tumorigenesis of prostate cancer cells.
15583694 These studies suggest that Ebp1 is an AR corepressor whose biological activity can be regulated by the ErbB3 ligand, HRG.
15073182 ErbB3-binding protein Ebp1 binding to E2F promoter elements and E2F-mediated transcription are regulated by heregulin.
15064750 EBP1 is in the cytoplasm & nucleolus. Nucleolar localization requires AA sequences at the NH2- and COOH-ends. Overexpression inhibits proliferation of human fibroblasts. It is part of RNP complexes & associates with different rRNAs.

AA Sequence

MSGEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKKEKEM      1 - 70
KKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDVAQGTQVTGRKA     71 - 140
DVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQK    141 - 210
KDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQRTTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTL    211 - 280
RAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQ    281 - 350
DAELKALLQSSASRKTQKKKKKKASKTAENATSGETLEENEAGD                              351 - 394
//

Text Mined References (75)

PMID Year Title
27346687 2016 DNAJC21 Mutations Link a Cancer-Prone Bone Marrow Failure Syndrome to Corruption in 60S Ribosome Subunit Maturation.
26436510 2015 Significance of Ebp1 and p53 protein expression in cervical cancer.
26256794 2015 ErbB3 binding protein 1 (EBP1) participates in the regulation of intestinal inflammation via mediating Akt signaling pathway.
26081906 2015 EBP1 protein modulates the expression of human MHC class II molecules in non-hematopoietic cancer cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25917452 2015 A novel Anxa2-interacting protein Ebp1 inhibits cancer proliferation and invasion by suppressing Anxa2 protein level.
25691158 2015 Regulation of ribosomal RNA synthesis in T cells: requirement for GTP and Ebp1.
25154617 2015 Phosphorylation of the N-terminal domain of p48 Ebp1 by CDK2 is required for tumorigenic function of p48.
24798454 2015 Androgen receptor (AR) inhibitor ErbB3-binding protein-1 (Ebp1) is not targeted by the newly identified AR controlling signaling axis heat-shock protein HSP27 and microRNA miR-1 in prostate cancer cells.
24651434 2014 P42 Ebp1 regulates the proteasomal degradation of the p85 regulatory subunit of PI3K by recruiting a chaperone-E3 ligase complex HSP70/CHIP.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23828502 2014 HIV-1 viral protein R downregulates Ebp1 and stabilizes p53 in glioblastoma U87MG cells.
23707440 2013 Identification of endothelial cell surface antigens encoded by genes other than HLA. A combined immunoprecipitation and proteomic approach for the identification of antigens recognized by antibodies against endothelial cells in transplant recipients.
23283744 2013 Down-regulation of the ErbB3 binding protein 1 in human bladder cancer promotes tumor progression and cell proliferation.
23242156 2013 ErbB3-binding protein EBP1 decreases ErbB2 levels via a transcriptional mechanism.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23110497 2012 Expression of ERBB3 binding protein 1 (EBP1) in salivary adenoid cystic carcinoma and its clinicopathological relevance.
22951725 2013 Association analyses identify three susceptibility Loci for vitiligo in the Chinese Han population.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21965718 2011 EBP1 inhibits translation of androgen receptor mRNA in castration resistant prostate cancer cells.
21930127 2012 Long isoform of ErbB3 binding protein, p48, mediates protein kinase B/Akt-dependent HDM2 stabilization and nuclear localization.
21794029 2011 Influenza virus infection induces cellular Ebp1 gene expression.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21145366 2011 p48 Ebp1 acts as a downstream mediator of Trk signaling in neurons, contributing neuronal differentiation.
21098709 2010 Negative regulation of p53 by the long isoform of ErbB3 binding protein Ebp1 in brain tumors.
21085677 2010 EBP1 is a novel E2F target gene regulated by transforming growth factor-?.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20379846 2011 The ErbB3 binding protein EBP1 regulates ErbB2 protein levels and tamoxifen sensitivity in breast cancer cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20048076 2010 ErbB3 binding protein 1 represses metastasis-promoting gene anterior gradient protein 2 in prostate cancer.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19037095 2009 Human BRE1 is an E3 ubiquitin ligase for Ebp1 tumor suppressor.
18852121 2008 EBP1, an ErbB3-binding protein, is decreased in prostate cancer and implicated in hormone resistance.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18355957 2008 Inhibition of heregulin mediated MCF-7 breast cancer cell growth by the ErbB3 binding protein EBP1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17951246 2007 Ebp1 association with nucleophosmin/B23 is essential for regulating cell proliferation and suppressing apoptosis.
17768350 2007 Expression, purification, crystallization and preliminary crystallographic analysis of the proliferation-associated protein Ebp1.
17765895 2007 The crystal structure of Ebp1 reveals a methionine aminopeptidase fold as binding platform for multiple interactions.
17641068 2007 Identification and characterization of ErbB-3-binding protein-1 as a target for immunotherapy.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17316401 2007 Protein kinase C-delta phosphorylates Ebp1 and prevents its proteolytic degradation, enhancing cell survival.
17295834 2007 Host factor Ebp1: selective inhibitor of influenza virus transcriptase.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16832058 2006 Ebp1 isoforms distinctively regulate cell survival and differentiation.
16642037 2006 Nuclear Akt associates with PKC-phosphorylated Ebp1, preventing DNA fragmentation by inhibition of caspase-activated DNase.
16631606 2006 Ebp1 is a dsRNA-binding protein associated with ribosomes that modulates eIF2alpha phosphorylation.
16396631 2006 Identification of Ebp1 as a component of cytoplasmic bcl-2 mRNP (messenger ribonucleoprotein particle) complexes.
16254079 2005 The ErbB3 binding protein Ebp1 interacts with Sin3A to repress E2F1 and AR-mediated transcription.
15994225 2005 The ErbB3-binding protein Ebp1 suppresses androgen receptor-mediated gene transcription and tumorigenesis of prostate cancer cells.
15635413 2005 Nucleolar proteome dynamics.
15583694 2005 Specificity and heregulin regulation of Ebp1 (ErbB3 binding protein 1) mediated repression of androgen receptor signalling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
15073182 2004 Heregulin regulates the ability of the ErbB3-binding protein Ebp1 to bind E2F promoter elements and repress E2F-mediated transcription.
15064750 2004 EBP1 is a nucleolar growth-regulating protein that is part of pre-ribosomal ribonucleoprotein complexes.
12682367 2003 Repression of E2F1-mediated transcription by the ErbB3 binding protein Ebp1 involves histone deacetylases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429849 2002 Functional proteomic analysis of human nucleolus.
12165860 2002 Repression of androgen receptor mediated transcription by the ErbB-3 binding protein, Ebp1.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11708806 2001 Analysis of the expression pattern of Ebp1, an ErbB-3-binding protein.
11325528 2001 Regulation of the ErbB3 binding protein Ebp1 by protein kinase C.
11268000 2001 Ebp1, an ErbB-3 binding protein, interacts with Rb and affects Rb transcriptional regulation.
10797306 2000 Ectopic expression of the ErbB-3 binding protein ebp1 inhibits growth and induces differentiation of human breast cancer cell lines.
10682683 2000 Interaction of the PA2G4 (EBP1) protein with ErbB-3 and regulation of this binding by heregulin.
9345902 1997 Molecular cloning and mapping of a human cDNA (PA2G4) that encodes a protein highly homologous to the mouse cell cycle protein p38-2G4.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7556453 1995 Molecular cloning of a murine cDNA encoding a novel protein, p38-2G4, which varies with the cell cycle.