Property Summary

NCBI Gene PubMed Count 107
PubMed Score 4945.65
PubTator Score 8760.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (18)

Disease log2 FC p
active ulcerative colitis -1.307 6.7e-03
adult high grade glioma -1.300 4.7e-03
aldosterone-producing adenoma -1.544 2.3e-02
astrocytic glioma -1.700 3.1e-03
Astrocytoma, Pilocytic -1.300 1.0e-05
atypical teratoid / rhabdoid tumor -2.400 1.2e-08
ependymoma -1.700 1.4e-02
glioblastoma -1.200 9.5e-05
hepatocellular carcinoma -2.300 5.0e-04
intraductal papillary-mucinous adenoma (... 1.300 2.7e-02
intraductal papillary-mucinous neoplasm ... 1.500 3.3e-02
invasive ductal carcinoma -1.200 1.9e-02
medulloblastoma -1.100 5.0e-03
medulloblastoma, large-cell -1.500 4.6e-04
oligodendroglioma -1.400 9.5e-03
osteosarcoma 3.726 9.0e-05
Pick disease 1.500 1.7e-02
psoriasis 1.400 3.8e-69

 OMIM Phenotype (1)

Gene RIF (67)

AA Sequence

MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLE      1 - 70
NPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE                                        71 - 105
//

Text Mined References (113)

PMID Year Title