Property Summary

NCBI Gene PubMed Count 14
Grant Count 299
R01 Count 220
Funding $48,390,459.32
PubMed Score 1155.19
PubTator Score 5.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Rheumatoid Arthritis 1.700 0.046
malignant mesothelioma 1.300 0.000
osteosarcoma -2.079 0.000
cystic fibrosis 1.146 0.002
atypical teratoid / rhabdoid tumor 1.100 0.011
medulloblastoma, large-cell -2.100 0.000
primary pancreatic ductal adenocarcinoma 1.104 0.015
tuberculosis 1.400 0.000
non-small cell lung cancer -1.622 0.000
intraductal papillary-mucinous neoplasm ... 2.000 0.045
lung cancer -1.300 0.005
active Crohn's disease 1.550 0.007
ulcerative colitis 2.100 0.000
lung carcinoma -1.300 0.000
gastric carcinoma 1.900 0.016
ovarian cancer -3.200 0.000
Breast cancer 1.200 0.001
pituitary cancer -2.700 0.000

Synonym

Accession P98196 Q5VXT2
Symbols ATPIH
ATPIS

Gene

PANTHER Protein Class (2)

 GWAS Trait (1)

Gene RIF (3)

PMID Text
20858683 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20043114 ATP11A is a useful predictive marker of metastasis in colorectal cancer patients.

AA Sequence

MDCSLVRTLVHRYCAGEENWVDSRTIYVGHREPPPGAEAYIPQRYPDNRIVSSKYTFWNFIPKNLFEQFR      1 - 70
RVANFYFLIIFLVQLIIDTPTSPVTSGLPLFFVITVTAIKQGYEDWLRHKADNAMNQCPVHFIQHGKLVR     71 - 140
KQSRKLRVGDIVMVKEDETFPCDLIFLSSNRGDGTCHVTTASLDGESSHKTHYAVQDTKGFHTEEDIGGL    141 - 210
HATIECEQPQPDLYKFVGRINVYSDLNDPVVRPLGSENLLLRGATLKNTEKIFGVAIYTGMETKMALNYQ    211 - 280
SKSQKRSAVEKSMNAFLIVYLCILISKALINTVLKYMWQSEPFRDEPWYNQKTESERQRNLFLKAFTDFL    281 - 350
AFMVLFNYIIPVSMYVTVEMQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLT    351 - 420
ENNMEFKECCIEGHVYVPHVICNGQVLPESSGIDMIDSSPSVNGREREELFFRALCLCHTVQVKDDDSVD    421 - 490
GPRKSPDGGKSCVYISSSPDEVALVEGVQRLGFTYLRLKDNYMEILNRENHIERFELLEILSFDSVRRRM    491 - 560
SVIVKSATGEIYLFCKGADSSIFPRVIEGKVDQIRARVERNAVEGLRTLCVAYKRLIQEEYEGICKLLQA    561 - 630
AKVALQDREKKLAEAYEQIEKDLTLLGATAVEDRLQEKAADTIEALQKAGIKVWVLTGDKMETAAATCYA    631 - 700
CKLFRRNTQLLELTTKRIEEQSLHDVLFELSKTVLRHSGSLTRDNLSGLSADMQDYGLIIDGAALSLIMK    701 - 770
PREDGSSGNYRELFLEICRSCSAVLCCRMAPLQKAQIVKLIKFSKEHPITLAIGDGANDVSMILEAHVGI    771 - 840
GVIGKEGRQAARNSDYAIPKFKHLKKMLLVHGHFYYIRISELVQYFFYKNVCFIFPQFLYQFFCGFSQQT    841 - 910
LYDTAYLTLYNISFTSLPILLYSLMEQHVGIDVLKRDPTLYRDVAKNALLRWRVFIYWTLLGLFDALVFF    911 - 980
FGAYFVFENTTVTSNGQIFGNWTFGTLVFTVMVFTVTLKLALDTHYWTWINHFVIWGSLLFYVVFSLLWG    981 - 1050
GVIWPFLNYQRMYYVFIQMLSSGPAWLAIVLLVTISLLPDVLKKVLCRQLWPTATERVQTKSQCLSVEQS   1051 - 1120
TIFMLSQTSSSLSF                                                           1121 - 1134
//

Text Mined References (16)

PMID Year Title
26567335 2016 Human Type IV P-type ATPases That Work as Plasma Membrane Phospholipid Flippases and Their Regulation by Caspase and Calcium.
23583980 2013 Genome-wide association study identifies multiple susceptibility loci for pulmonary fibrosis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21914794 2011 ATP9B, a P4-ATPase (a putative aminophospholipid translocase), localizes to the trans-Golgi network in a CDC50 protein-independent manner.
20858683 2010 Common variants at 10 genomic loci influence hemoglobin A?(C) levels via glycemic and nonglycemic pathways.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20043114 2010 ATP11A is a novel predictive marker for metachronous metastasis of colorectal cancer.
19946888 2010 Defining the membrane proteome of NK cells.
17897319 2007 Integral and associated lysosomal membrane proteins.
15860663 2005 Resistance to farnesyltransferase inhibitors in Bcr/Abl-positive lymphoblastic leukemia by increased expression of a novel ABC transporter homolog ATP11a.
More...