Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1708.81
PubTator Score 5.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
active Crohn's disease 1.550 6.8e-03
active ulcerative colitis 1.315 2.5e-02
atypical teratoid / rhabdoid tumor 1.100 1.1e-02
Breast cancer 1.200 1.1e-03
cystic fibrosis 1.146 2.1e-03
gastric carcinoma 1.900 1.6e-02
intraductal papillary-mucinous neoplasm ... 2.000 4.5e-02
lung cancer -1.300 4.9e-03
lung carcinoma -1.300 3.5e-21
malignant mesothelioma 1.300 4.8e-04
medulloblastoma, large-cell -2.100 2.6e-06
non-small cell lung cancer -1.622 3.3e-10
osteosarcoma -2.079 4.2e-05
ovarian cancer -3.200 2.3e-06
pituitary cancer -1.800 9.2e-07
primary pancreatic ductal adenocarcinoma 1.104 1.5e-02
Rheumatoid arthritis 1.700 4.6e-02
tuberculosis 1.400 3.3e-06

Gene RIF (4)

AA Sequence

MDCSLVRTLVHRYCAGEENWVDSRTIYVGHREPPPGAEAYIPQRYPDNRIVSSKYTFWNFIPKNLFEQFR      1 - 70
RVANFYFLIIFLVQLIIDTPTSPVTSGLPLFFVITVTAIKQGYEDWLRHKADNAMNQCPVHFIQHGKLVR     71 - 140
KQSRKLRVGDIVMVKEDETFPCDLIFLSSNRGDGTCHVTTASLDGESSHKTHYAVQDTKGFHTEEDIGGL    141 - 210
HATIECEQPQPDLYKFVGRINVYSDLNDPVVRPLGSENLLLRGATLKNTEKIFGVAIYTGMETKMALNYQ    211 - 280
SKSQKRSAVEKSMNAFLIVYLCILISKALINTVLKYMWQSEPFRDEPWYNQKTESERQRNLFLKAFTDFL    281 - 350
AFMVLFNYIIPVSMYVTVEMQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLT    351 - 420
ENNMEFKECCIEGHVYVPHVICNGQVLPESSGIDMIDSSPSVNGREREELFFRALCLCHTVQVKDDDSVD    421 - 490
GPRKSPDGGKSCVYISSSPDEVALVEGVQRLGFTYLRLKDNYMEILNRENHIERFELLEILSFDSVRRRM    491 - 560
SVIVKSATGEIYLFCKGADSSIFPRVIEGKVDQIRARVERNAVEGLRTLCVAYKRLIQEEYEGICKLLQA    561 - 630
AKVALQDREKKLAEAYEQIEKDLTLLGATAVEDRLQEKAADTIEALQKAGIKVWVLTGDKMETAAATCYA    631 - 700
CKLFRRNTQLLELTTKRIEEQSLHDVLFELSKTVLRHSGSLTRDNLSGLSADMQDYGLIIDGAALSLIMK    701 - 770
PREDGSSGNYRELFLEICRSCSAVLCCRMAPLQKAQIVKLIKFSKEHPITLAIGDGANDVSMILEAHVGI    771 - 840
GVIGKEGRQAARNSDYAIPKFKHLKKMLLVHGHFYYIRISELVQYFFYKNVCFIFPQFLYQFFCGFSQQT    841 - 910
LYDTAYLTLYNISFTSLPILLYSLMEQHVGIDVLKRDPTLYRDVAKNALLRWRVFIYWTLLGLFDALVFF    911 - 980
FGAYFVFENTTVTSNGQIFGNWTFGTLVFTVMVFTVTLKLALDTHYWTWINHFVIWGSLLFYVVFSLLWG    981 - 1050
GVIWPFLNYQRMYYVFIQMLSSGPAWLAIVLLVTISLLPDVLKKVLCRQLWPTATERVQTKSQCLSVEQS   1051 - 1120
TIFMLSQTSSSLSF                                                           1121 - 1134
//

Text Mined References (17)

PMID Year Title