Property Summary

NCBI Gene PubMed Count 80
PubMed Score 742.07
PubTator Score 276.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Pemphigus, Benign Familial 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Endometrial cancer 311 0.0 0.5
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Hailey-Hailey disease 6 0.0 5.0
Disease Target Count
Benign Chronic Pemphigus 1

Expression

  Differential Expression (20)

Disease log2 FC p
active Crohn's disease 1.568 6.5e-03
active ulcerative colitis 1.677 1.9e-02
acute myeloid leukemia -1.100 4.4e-02
adult high grade glioma -1.100 1.2e-02
astrocytic glioma -1.100 1.2e-02
atypical teratoid / rhabdoid tumor -1.600 1.5e-04
ependymoma -1.400 4.1e-02
glioblastoma -1.400 2.0e-05
group 4 medulloblastoma -1.200 6.3e-03
intraductal papillary-mucinous adenoma (... 1.100 1.6e-03
intraductal papillary-mucinous carcinoma... 1.300 5.3e-03
intraductal papillary-mucinous neoplasm ... 1.500 7.2e-03
medulloblastoma, large-cell -1.600 2.9e-03
nasopharyngeal carcinoma 1.200 4.1e-04
osteosarcoma -1.063 1.6e-02
ovarian cancer -1.200 7.3e-06
Pick disease -1.100 2.0e-03
primitive neuroectodermal tumor -1.300 1.7e-04
psoriasis 1.200 6.8e-04
subependymal giant cell astrocytoma 1.063 1.4e-02

 OMIM Phenotype (1)

Gene RIF (65)

AA Sequence

MKVARFQKIPNGENETMIPVLTSKKASELPVSEVASILQADLQNGLNKCEVSHRRAFHGWNEFDISEDEP      1 - 70
LWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECH     71 - 140
CVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDL    141 - 210
ASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGII    211 - 280
MLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSD    281 - 350
KTGTLTKNEMTVTHIFTSDGLHAEVTGVGYNQFGEVIVDGDVVHGFYNPAVSRIVEAGCVCNDAVIRNNT    351 - 420
LMGKPTEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRTQQDRPEICFMKGAYEQVIKYC    421 - 490
TTYQSKGQTLTLTQQQRDVYQQEKARMGSAGLRVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLI    491 - 560
ASGVSIKMITGDSQETAVAIASRLGLYSKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIK    561 - 630
SLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIK    631 - 700
NFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSI    701 - 770
LTKNLILKILVSSIIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCS    771 - 840
NRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVAEIIKKVERSREKIQKHVS    841 - 910
STSSSFLEV                                                                 911 - 919
//

Text Mined References (85)

PMID Year Title