Property Summary

NCBI Gene PubMed Count 34
PubMed Score 64.87
PubTator Score 41.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Gene RIF (22)

AA Sequence

MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGE      1 - 70
SLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQ     71 - 140
GGYDRYSGGNYRDNYDN                                                         141 - 157
//

Text Mined References (39)

PMID Year Title