Property Summary

NCBI Gene PubMed Count 30
Grant Count 28
R01 Count 23
Funding $1,128,449.24
PubMed Score 57.31
PubTator Score 41.80

Knowledge Summary

Patent

No data available

Expression

Gene RIF (18)

PMID Text
26825461 The results indicate the existence of a negative feedback loop that regulates fever via reduced RBM3 levels and increased expression of miR-142-5p and miR-143.
26577765 Low RBM3 immunoexpression is associated with urothelial carcinoma of the bladder.
25811459 RBM3 may be a potential biomarker for treatment stratification in patients with metastatic non-seminomatous germ cell tumours.
24380696 High RBM3 expression is an independent prognostic marker in prostate cancer.
23673116 The data suggest that the overexpression of RBM3 may serve as an important molecular mechanism underlying astrocytic carcinogenesis.
23667174 A novel role of RBM3 in linking stress-regulated RNA splicing to tumorigenesis.
23565664 Loss of RBM3 expression is associated with more aggressive tumors and poorer prognosis of urothelial bladder cancer. Findings may indicate that loss of RBM3 expression results in a phenotype more prone to metastatic spread than local aggressiveness.
22805320 the inverse association and prognostic impact of MCM3 and RBM3 expression indicate a possible interaction of these proteins in melanoma progression
21956899 high tumor-specific nuclear expression of RBM3 is an independent predictor of good prognosis in colorectal cancer
21955582 high nuclear expression of RBM3 in prostate cancer is associated with a prolonged time to disease progression
More...

AA Sequence

MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGE      1 - 70
SLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQ     71 - 140
GGYDRYSGGNYRDNYDN                                                         141 - 157
//

Text Mined References (35)

PMID Year Title
26825461 2016 RBM3 regulates temperature sensitive miR-142-5p and miR-143 (thermomiRs), which target immune genes and control fever.
26577765 2015 Evaluation of RNA-binding motif protein 3 expression in urothelial carcinoma of the bladder: an immunohistochemical study.
25811459 2015 Low RBM3 protein expression correlates with clinical stage, prognostic classification and increased risk of treatment failure in testicular non-seminomatous germ cell cancer.
25416956 2014 A proteome-scale map of the human interactome network.
24380696 2014 High RNA-binding motif protein 3 expression is an independent prognostic marker in operated prostate cancer and tightly linked to ERG activation and PTEN deletions.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23673116 2013 Differential expression of the RNA-binding motif protein 3 in human astrocytoma.
23667174 2013 Stress-response protein RBM3 attenuates the stem-like properties of prostate cancer cells by interfering with CD44 variant splicing.
23565664 2013 Decreased expression of RNA-binding motif protein 3 correlates with tumour progression and poor prognosis in urothelial bladder cancer.
More...