Property Summary

NCBI Gene PubMed Count 90
PubMed Score 278.04
PubTator Score 76.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
juvenile dermatomyositis 1187 3.0e-09
osteosarcoma 7950 9.0e-09
psoriasis 6694 1.2e-05
medulloblastoma, large-cell 6241 3.4e-05
adult high grade glioma 3801 1.6e-04
lung cancer 4740 4.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 4.16 2.1
Disease Target Count Z-score Confidence
Cutaneous fibrous histiocytoma 17 4.719 2.4
Aortic aneurysm 38 3.319 1.7

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.100 1.6e-04
juvenile dermatomyositis -1.034 3.0e-09
lung cancer -1.300 4.3e-02
medulloblastoma, large-cell -1.400 3.4e-05
osteosarcoma -3.746 9.0e-09
psoriasis -2.700 1.2e-05

 IMPC Phenotype (1)

Gene RIF (66)

AA Sequence

MDPGNENSATEAAAIIDLDPDFEPQSRPRSCTWPLPRPEIANQPSEPPEVEPDLGEKVHTEGRSEPILLP      1 - 70
SRLPEPAGGPQPGILGAVTGPRKGGSRRNAWGNQSYAELISQAIESAPEKRLTLAQIYEWMVRTVPYFKD     71 - 140
KGDSNSSAGWKNSIRHNLSLHSKFIKVHNEATGKSSWWMLNPEGGKSGKAPRRRAASMDSSSKLLRGRSK    141 - 210
APKKKPSVLPAPPEGATPTSPVGHFAKWSGSPCSRNREEADMWTTFRPRSSSNASSVSTRLSPLRPESEV    211 - 280
LAEEIPASVSSYAGGVPPTLNEGLELLDGLNLTSSHSLLSRSGLSGFSLQHPGVTGPLHTYSSSLFSPAE    281 - 350
GPLSAGEGCFSSSQALEALLTSDTPPPPADVLMTQVDPILSQAPTLLLLGGLPSSSKLATGVGLCPKPLE    351 - 420
APGPSSLVPTLSMIAPPPVMASAPIPKALGTPVLTPPTEAASQDRMPQDLDLDMYMENLECDMDNIISDL    421 - 490
MDEGEGLDFNFEPDP                                                           491 - 505
//

Text Mined References (93)

PMID Year Title