Property Summary

NCBI Gene PubMed Count 85
Grant Count 52
R01 Count 31
Funding $2,316,557.22
PubMed Score 252.73
PubTator Score 76.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -2.700 0.000
osteosarcoma -3.746 0.000
medulloblastoma, large-cell -1.400 0.000
juvenile dermatomyositis -1.034 0.000
lung cancer -1.300 0.043
adult high grade glioma -1.100 0.000

Gene RIF (62)

PMID Text
26715362 The data demonstrated that elevated miR-150 targets FOXO4 expression and therefore regulates multiple genes expression, resulting in cervical cancer cell growth and survival.
26463624 miR-664 functions as an oncogene miRNA and has an important role in promoting human osteosarcoma cell proliferation by suppressing FOXO4 expression.
25958948 Porphyromonas gingivalis-induced reactive oxygen species activate FOXO transcription factors through JNK signalling, and that FOXO1 controls oxidative stress responses, inflammatory cytokine production and cell survival.
25753202 study demonstrated that miR-1274a prompted gastric cancer cells growth and migration through dampening FOXO4 expression thus provided a potential target for human gastric cancer therapy
25648147 FOXOs support the metabolic requirements of normal and tumor cells by promoting IDH1 expression.
25053419 Data indicate that glycogen synthase kinase 3 beta (GSK3beta) and transcription factors FOXO1/3/4 promote hepatoma cell proliferation through type I insulin-like growth factor receptor (IGF-IR).
25007147 Case Report: CIC-FOXO4 fusion sarcoma is a new type of Ewing-like sarcoma that has a specific genetic signature.
24984152 results demonstrate that HKa accelerates the onset of EPC senescence by stimulating JNK/FOXO4/MnSOD pathway, its effect is mediated by the HC
24983969 data strongly suggest that increased PI3K/AKT-mediated metastatic invasiveness in CaP is associated with FOXO4 loss, and that mechanisms to induce FOXO4 re-expression might suppress CaP metastatic aggressiveness.
24935588 Cox regression analysis indicated FoxO4 to be an independent prognostic factor in non-small cell lung cancers and suggested that FoxO4 might inhibit the process of EMT in non-small cell lung cancers, and might therefore be a target for therapy.
More...

AA Sequence

MDPGNENSATEAAAIIDLDPDFEPQSRPRSCTWPLPRPEIANQPSEPPEVEPDLGEKVHTEGRSEPILLP      1 - 70
SRLPEPAGGPQPGILGAVTGPRKGGSRRNAWGNQSYAELISQAIESAPEKRLTLAQIYEWMVRTVPYFKD     71 - 140
KGDSNSSAGWKNSIRHNLSLHSKFIKVHNEATGKSSWWMLNPEGGKSGKAPRRRAASMDSSSKLLRGRSK    141 - 210
APKKKPSVLPAPPEGATPTSPVGHFAKWSGSPCSRNREEADMWTTFRPRSSSNASSVSTRLSPLRPESEV    211 - 280
LAEEIPASVSSYAGGVPPTLNEGLELLDGLNLTSSHSLLSRSGLSGFSLQHPGVTGPLHTYSSSLFSPAE    281 - 350
GPLSAGEGCFSSSQALEALLTSDTPPPPADVLMTQVDPILSQAPTLLLLGGLPSSSKLATGVGLCPKPLE    351 - 420
APGPSSLVPTLSMIAPPPVMASAPIPKALGTPVLTPPTEAASQDRMPQDLDLDMYMENLECDMDNIISDL    421 - 490
MDEGEGLDFNFEPDP                                                           491 - 505
//

Text Mined References (88)

PMID Year Title
26715362 2015 microRNA-150 promotes cervical cancer cell growth and survival by targeting FOXO4.
26463624 2015 Mir-664 promotes osteosarcoma cells proliferation via downregulating of FOXO4.
25958948 2015 FOXO responses to Porphyromonas gingivalis in epithelial cells.
25753202 2015 The role of microRNA-1274a in the tumorigenesis of gastric cancer: accelerating cancer cell proliferation and migration via directly targeting FOXO4.
25648147 2015 FOXOs support the metabolic requirements of normal and tumor cells by promoting IDH1 expression.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25416956 2014 A proteome-scale map of the human interactome network.
25053419 2014 GSK3 protein positively regulates type I insulin-like growth factor receptor through forkhead transcription factors FOXO1/3/4.
25007147 2014 A novel CIC-FOXO4 gene fusion in undifferentiated small round cell sarcoma: a genetically distinct variant of Ewing-like sarcoma.
24984152 2014 Cleaved high molecular weight kininogen stimulates JNK/FOXO4/MnSOD pathway for induction of endothelial progenitor cell senescence.
More...