Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.48
PubTator Score 16.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
IGA Glomerulonephritis 454
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.008 0.003

Gene RIF (4)

PMID Text
24806753 FAM3A plays crucial roles in the regulation of glucose and lipid metabolism in the liver, where it activates the PI3K-Akt signaling pathway by way of a Ca(2+) /CaM-dependent mechanism
23562554 Upregulation of FAM3A by PPARgamma activation is correlated with increased pAkt level in liver cells
18212107 In the present study, we report a putative human homologue of the antimicrobial Drosophila-derived drosomycin, designated drosomycin-like defensin (DLD), with specific antifungal activity.
12160727 Expressed prominently in the vascular endothelium, particularly capillaries, also in islets of Langerhans.

AA Sequence

MRLAGPLRIVVLVVSVGVTWIVVSILLGGPGSGFPRIQQLFTSPESSVTAAPRARKYKCGLPQPCPEEHL      1 - 70
AFRVVSGAANVIGPKICLEDKMLMSSVKDNVGRGLNIALVNGVSGELIEARAFDMWAGDVNDLLKFIRPL     71 - 140
HEGTLVFVASYDDPATKMNEETRKLFSELGSRNAKELAFRDSWVFVGAKGVQNKSPFEQHVKNSKHSNKY    141 - 210
EGWPEALEMEGCIPRRSTAS                                                      211 - 230
//

Text Mined References (15)

PMID Year Title
24806753 2014 FAM3A activates PI3K p110?/Akt signaling to ameliorate hepatic gluconeogenesis and lipogenesis.
23855304 2013 Family with sequence similarity 3 gene family and nonalcoholic fatty liver disease.
23562554 2013 FAM3A is a target gene of peroxisome proliferator-activated receptor gamma.
23446634 2013 Genome-wide association analysis of red blood cell traits in African Americans: the COGENT Network.
18212107 2008 Drosomycin-like defensin, a human homologue of Drosophila melanogaster drosomycin with antifungal activity.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16406369 2006 GG: a domain involved in phage LTF apparatus and implicated in human MEB and non-syndromic hearing loss diseases.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...