Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.50
PubTator Score 16.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 3.2e-03
Disease Target Count Z-score Confidence
Fatty liver disease 103 3.103 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.008 3.2e-03

Synonym

Accession P98173 A6QRH6 B2RBI7 B4DFI8 D3DWX4 Q5HY76 Q96H51
Symbols DLD
2.19
XAP-7
DXS560S

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (5)

AA Sequence

MRLAGPLRIVVLVVSVGVTWIVVSILLGGPGSGFPRIQQLFTSPESSVTAAPRARKYKCGLPQPCPEEHL      1 - 70
AFRVVSGAANVIGPKICLEDKMLMSSVKDNVGRGLNIALVNGVSGELIEARAFDMWAGDVNDLLKFIRPL     71 - 140
HEGTLVFVASYDDPATKMNEETRKLFSELGSRNAKELAFRDSWVFVGAKGVQNKSPFEQHVKNSKHSNKY    141 - 210
EGWPEALEMEGCIPRRSTAS                                                      211 - 230
//

Text Mined References (18)

PMID Year Title