Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.48
PubTator Score 16.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
osteosarcoma 7933 0.00317897679673295

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.008 0.003

Synonym

Accession P98173 A6QRH6 B2RBI7 B4DFI8 D3DWX4 Q5HY76 Q96H51
Symbols DLD
2.19
XAP-7
DXS560S

Gene

  Ortholog (9)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (4)

PMID Text
24806753 FAM3A plays crucial roles in the regulation of glucose and lipid metabolism in the liver, where it activates the PI3K-Akt signaling pathway by way of a Ca(2+) /CaM-dependent mechanism
23562554 Upregulation of FAM3A by PPARgamma activation is correlated with increased pAkt level in liver cells
18212107 In the present study, we report a putative human homologue of the antimicrobial Drosophila-derived drosomycin, designated drosomycin-like defensin (DLD), with specific antifungal activity.
12160727 Expressed prominently in the vascular endothelium, particularly capillaries, also in islets of Langerhans.

AA Sequence

MRLAGPLRIVVLVVSVGVTWIVVSILLGGPGSGFPRIQQLFTSPESSVTAAPRARKYKCGLPQPCPEEHL      1 - 70
AFRVVSGAANVIGPKICLEDKMLMSSVKDNVGRGLNIALVNGVSGELIEARAFDMWAGDVNDLLKFIRPL     71 - 140
HEGTLVFVASYDDPATKMNEETRKLFSELGSRNAKELAFRDSWVFVGAKGVQNKSPFEQHVKNSKHSNKY    141 - 210
EGWPEALEMEGCIPRRSTAS                                                      211 - 230
//

Text Mined References (15)

PMID Year Title
24806753 2014 FAM3A activates PI3K p110?/Akt signaling to ameliorate hepatic gluconeogenesis and lipogenesis.
23855304 2013 Family with sequence similarity 3 gene family and nonalcoholic fatty liver disease.
23562554 2013 FAM3A is a target gene of peroxisome proliferator-activated receptor gamma.
23446634 2013 Genome-wide association analysis of red blood cell traits in African Americans: the COGENT Network.
18212107 2008 Drosomycin-like defensin, a human homologue of Drosophila melanogaster drosomycin with antifungal activity.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16406369 2006 GG: a domain involved in phage LTF apparatus and implicated in human MEB and non-syndromic hearing loss diseases.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...