Property Summary

NCBI Gene PubMed Count 71
PubMed Score 187.69
PubTator Score 114.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -1.500 7.1e-06
breast carcinoma -1.100 6.6e-04
fibroadenoma -1.300 2.3e-03
lung adenocarcinoma -1.300 1.2e-06

 GO Function (1)

Gene RIF (40)

PMID Text
26580852 While ephrin-B1 deficiency leads to abnormal visual pathways in mice, it leaves the human visual system, apart from deficits in binocular vision, largely normal.
25779027 T cells from rheumatoid arthritis (RA) patients expressed higher EFNB1 mRNA levels, which correlated with RA symptoms and laboratory findings. Expression of EFNB1 in T cells might be a parameter for monitoring RA disease activity and treatment responses.
25643922 EphB2/ephrin-B1 were invoked in dental pulp stem cells with TNF-alpha treatment via the JNK-dependent pathway, but not NF-kB, p38 MAPK or MEK signalling.
25486017 we report a family with a G151S mutation in the EFNB1 gene. The mutation was identified in two severely affected sisters and paradoxically in their clinically unaffected father.
25436983 that EphrinB1 (EFNB1) co-localizes with microtubules (MTs) during all phases of the cell cycle.
25258252 Results indicate that EphrinB1 is uniquely dysregulated in medulloblastoma and promotes oncogenic responses in medulloblastoma cells, implicating ephrinB1 as a potential target
24825906 CNK1 mediates ephrinB1 signaling that promotes cell migration through RhoA and JNK activity.
24281372 Patients with EFNB1 mutations have a clear phenotype. This study will facilitate genetic counseling of parents and patients, and contribute to the diagnostic and screening process of patients with suspected CFNS.
24240587 EphrinB1 expression is related to the metastasis of breast cancer and its enhanced expression confers a poor prognosis, suggesting that EphrinB1 may be a relevant therapeutic target in breast cancers.
23811940 High EFNB1 expression is associated with squamous cell carcinomas of the head and neck.
23335590 we report the identification of mosaic EFNB1 mutations in every individual with craniofrontonasal syndrome, confirming the suggested diagnosis and supporting the hypothesis of cellular interference in humans.
22718351 These results indicate a novel function of Nm23-H1 to control contact inhibition of locomotion, and its negative regulation by ephrin-B1.
22279592 Data show that EphrinB1, a PTPN13 substrate, interacts with ErbB2, and Src kinase mediates EphrinB1 phosphorylation and subsequent MAP Kinase signaling.
21542058 X-linked cases resembling Teebi hypertelorism may have a similar mechanism to CFNS, and that cellular mosaicism for different levels of ephrin-B1 (as well as simple presence/absence) leads to craniofacial abnormalities.
20734337 Unreported mutation in EFNB1 predicts occurrence of congenital diaphragmatic hernia, phenotypic differences between males and female.
20643727 Observational study of gene-disease association. (HuGE Navigator)
20565770 The impact of craniofrontonasal syndrome-causing EFNB1 mutations on ephrin-B1 function is reported.
20308325 study reports that the expression of ephrin-B1 is controlled by a feedback loop involving posttranscriptional regulatory mechanisms
19672298 combination of SDF-1, PTN, IGF2, and EFNB1 mimics the DA phenotype-inducing property of SDIA and was sufficient to promote differentiation of hESC to functional midbrain DA neurons
18627045 Several new EFNB1 mutations have been identified in craniofrontonasal syndrome.
18314490 Ephrin-B1 is likely to play an important role in the regulation of malignant T lymphocytes through the control of lipid-raft-associated signaling, adhesion, and invasive activity
18043713 EFNB1 mutant transcripts with nonsense codons are degraded by the nonsense-mediated mRNA decay pathway and lead to craniofrontonasal syndrome.
17942634 EphrinB1 may play an important role in the inflammatory states of rheumatoid arthritis, by affecting the population/function of T cells.
17906625 Silencing of EphB expression is associated with colorectal tumorigenesis.
17591954 Our results suggest that tyrosine phosphorylation of ephrin-B1 promotes invasion of cancer cells in vivo
17567680 C-terminus of ephrin-B1 regulates activation of the extracellular release of MMP-8 without requirement of de novo protein synthesis.
17204606 EphB/ephrin-B molecules play a role in restricting dental pulp stem cell attachment and migration to maintain Dthesse cells within their stem cell niche under steady-state conditions.
15959873 EFNB1 mutations have a role in familial and sporadic craniofrontonasal syndrome (CFNS)
15725075 On ephrinB1 stimulation, the small GTPases Rho and Ras are activated and Rap1 is inactivated.
15351694 ephrin-B1 internalization is an active receptor-mediated process that utilizes the clathrin-mediated endocytic pathway
15124102 Mutations of the ephrin-B1 gene cause craniofrontonasal syndrome
14642617 Ephrin-B1 may be involved in in vivo tumor progression by promoting neovascularization in hepatocellular carcinoma
14576067 Eph/ephrin signaling enhances the ability of platelet agonists to cause aggregation by activating Rap1 and these effects require oligomerization of ephrinB1 but not phosphotyrosine-based interactions with the ephrinB1 cytoplasmic domain.
12919674 conclude that ephrinB1 and B class Eph receptors provide positional cues required for the normal morphogenesis of skeletal elements
12475948 Ephrin B1 induces human aortic endothelial cells migration in a pathway that involves Crk adaptor protein
12384430 expression of Eph-B1 in plasmacytoid dendritic cells
12223469 Results identified a novel interaction between EphB1 with the adaptor molecule Grb7 and suggested that this interaction may play a role in the regulation of cell migration by EphB1.
12209731 The expression of ephrin-B1 was correlated with a poorer clinical prognosis. Ephrin-B1 protein was expressed by osteosarcoma cells and blood vessels.
12136247 Expression profile of this ligand of EPHB2 in gastric cancer
12084815 Human platelets express EphA4 and EphB1, and the ligand, ephrinB1. Forced clustering of EphA4 or ephrinB1 led to cytoskeletal reorganization, adhesion to fibrinogen, and alpha-granule secretion.

AA Sequence

MARPGQRWLGKWLVAMVVWALCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAG      1 - 70
RPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNG     71 - 140
SLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHE    141 - 210
TVNQEEKSGPGASGGSSGDPDGFFNSKVALFAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAAL    211 - 280
SLSTLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV        281 - 346
//

Text Mined References (75)

PMID Year Title
26580852 2015 Visual Pathways in Humans With Ephrin-B1 Deficiency Associated With the Cranio-Fronto-Nasal Syndrome.
25779027 2015 Role of EFNB1 and EFNB2 in Mouse Collagen-Induced Arthritis and Human Rheumatoid Arthritis.
25643922 2015 Stimulation of EphB2/ephrin-B1 signalling by tumour necrosis factor alpha in human dental pulp stem cells.
25486017 2015 Report of a family with craniofrontonasal syndrome.
25436983 2015 EphrinB1: novel microtubule associated protein whose expression affects taxane sensitivity.
25258252 2015 EphrinB1 expression is dysregulated and promotes oncogenic signaling in medulloblastoma.
24825906 2014 EphrinB1 interacts with CNK1 and promotes cell migration through c-Jun N-terminal kinase (JNK) activation.
24281372 2014 Phenotypes of craniofrontonasal syndrome in patients with a pathogenic mutation in EFNB1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24240587 2013 Enhanced expression of EphrinB1 is associated with lymph node metastasis and poor prognosis in breast cancer.
23811940 2013 Targeting ERBB receptors shifts their partners and triggers persistent ERK signaling through a novel ERBB/EFNB1 complex.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23335590 2013 Cellular interference in craniofrontonasal syndrome: males mosaic for mutations in the X-linked EFNB1 gene are more severely affected than true hemizygotes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22718351 2012 Nm23-H1 regulates contact inhibition of locomotion, which is affected by ephrin-B1.
22279592 2012 ErbB2, EphrinB1, Src kinase and PTPN13 signaling complex regulates MAP kinase signaling in human cancers.
21542058 2011 Duplication of the EFNB1 gene in familial hypertelorism: imbalance in ephrin-B1 expression and abnormal phenotypes in humans and mice.
21429299 2011 EphrinB1 interacts with the transcriptional co-repressor Groucho/xTLE4.
20734337 2010 A novel EFNB1 mutation (c.712delG) in a family with craniofrontonasal syndrome and diaphragmatic hernia.
20643727 2010 Prevalence and complications of single-gene and chromosomal disorders in craniosynostosis.
20565770 2010 The impact of CFNS-causing EFNB1 mutations on ephrin-B1 function.
20308325 2010 Ephrin-B1 reverse signaling controls a posttranscriptional feedback mechanism via miR-124.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19672298 2009 A novel combination of factors, termed SPIE, which promotes dopaminergic neuron differentiation from human embryonic stem cells.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18627045 2008 Additional EFNB1 mutations in craniofrontonasal syndrome.
18314490 2008 In human leukemia cells ephrin-B-induced invasive activity is supported by Lck and is associated with reassembling of lipid raft signaling complexes.
18043713 2008 Dissecting the molecular mechanisms in craniofrontonasal syndrome: differential mRNA expression of mutant EFNB1 and the cellular mosaic.
17942634 2008 Enhancement of lymphocyte migration and cytokine production by ephrinB1 system in rheumatoid arthritis.
17906625 2007 EphB-ephrin-B interactions suppress colorectal cancer progression by compartmentalizing tumor cells.
17591954 2007 Phosphorylation of ephrin-B1 regulates dissemination of gastric scirrhous carcinoma.
17567680 2007 The C-terminus of ephrin-B1 regulates metalloproteinase secretion and invasion of cancer cells.
17204606 2007 EphB/ephrin-B interaction mediates adult stem cell attachment, spreading, and migration: implications for dental tissue repair.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16526919 2006 A novel mutation in EFNB1, probably with a dominant negative effect, underlying craniofrontonasal syndrome.
15959873 2005 Twenty-six novel EFNB1 mutations in familial and sporadic craniofrontonasal syndrome (CFNS).
15772651 2005 The DNA sequence of the human X chromosome.
15725075 2005 Down-regulation of Rap1 activity is involved in ephrinB1-induced cell contraction.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15351694 2004 Reverse endocytosis of transmembrane ephrin-B ligands via a clathrin-mediated pathway.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15166289 2004 Mutations of ephrin-B1 (EFNB1), a marker of tissue boundary formation, cause craniofrontonasal syndrome.
15124102 2004 Mutations of the ephrin-B1 gene cause craniofrontonasal syndrome.
14988728 2004 Tiam1 mediates neurite outgrowth induced by ephrin-B1 and EphA2.
14642617 2003 Expression of ephrin-B1 in hepatocellular carcinoma: possible involvement in neovascularization.
14576067 2004 Signaling by ephrinB1 and Eph kinases in platelets promotes Rap1 activation, platelet adhesion, and aggregation via effector pathways that do not require phosphorylation of ephrinB1.
12919674 2003 Control of skeletal patterning by ephrinB1-EphB interactions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475948 2002 Adaptor protein Crk is required for ephrin-B1-induced membrane ruffling and focal complex assembly of human aortic endothelial cells.
12209731 2002 Human osteosarcoma expresses specific ephrin profiles: implications for tumorigenicity and prognosis.
12136247 2002 Expression profile of EFNB1, EFNB2, two ligands of EPHB2 in human gastric cancer.
12084815 2002 Interactions between Eph kinases and ephrins provide a mechanism to support platelet aggregation once cell-to-cell contact has occurred.
11557983 2001 The SH2/SH3 adaptor Grb4 transduces B-ephrin reverse signals.
11466320 2001 In vivo tyrosine phosphorylation sites of activated ephrin-B1 and ephB2 from neural tissue.
11301003 2001 Ephrin-B reverse signaling is mediated by a novel PDZ-RGS protein and selectively inhibits G protein-coupled chemoattraction.
11256076 2001 Multiple roles of EPH receptors and ephrins in neural development.
11128993 2000 Roles of Eph receptors and ephrins in segmental patterning.
10730216 2000 Eph receptors and ephrins: regulators of guidance and assembly.
10669731 2000 Nck-interacting Ste20 kinase couples Eph receptors to c-Jun N-terminal kinase and integrin activation.
10207129 1999 Eph receptors and ephrins: effectors of morphogenesis.
10197531 1999 EphrinB ligands recruit GRIP family PDZ adaptor proteins into raft membrane microdomains.
9920925 1999 The carboxyl terminus of B class ephrins constitutes a PDZ domain binding motif.
9883737 1998 PDZ proteins bind, cluster, and synaptically colocalize with Eph receptors and their ephrin ligands.
9576626 1998 The Eph family receptors and ligands.
9530499 1998 The ephrins and Eph receptors in neural development.
9302274 1997 A novel phenotypic pattern in X-linked inheritance: craniofrontonasal syndrome maps to Xp22.
9267020 1997 Unified nomenclature for Eph family receptors and their ligands, the ephrins. Eph Nomenclature Committee.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8878483 1996 Bidirectional signalling through the EPH-family receptor Nuk and its transmembrane ligands.
8798744 1996 Cell-cell adhesion mediated by binding of membrane-anchored ligand LERK-2 to the EPH-related receptor human embryonal kinase 2 promotes tyrosine kinase activity.
8660976 1996 The genes encoding the eph-related receptor tyrosine kinase ligands LERK-1 (EPLG1, Epl1), LERK-3 (EPLG3, Epl3), and LERK-4 (EPLG4, Epl4) are clustered on human chromosome 1 and mouse chromosome 3.
8070404 1994 Molecular characterization of a family of ligands for eph-related tyrosine kinase receptors.
7973638 1994 Ligands for EPH-related receptor tyrosine kinases that require membrane attachment or clustering for activity.
7774950 1995 Assignment of the gene (EPLG2) encoding a high-affinity binding protein for the receptor tyrosine kinase elk to a 200-kilobasepair region in human chromosome Xq12.