Property Summary

NCBI Gene PubMed Count 71
Grant Count 118
R01 Count 60
Funding $11,723,083.26
PubMed Score 187.69
PubTator Score 114.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -1.500 0.000
breast carcinoma -1.100 0.001
fibroadenoma -1.300 0.002
lung adenocarcinoma -1.300 0.000

Synonym

Accession P98172 D3DVU0
Symbols CFND
CFNS
EFB1
EFL3
EPLG2
Elk-L
LERK2

Gene

 GO Function (1)

Gene RIF (40)

PMID Text
26580852 While ephrin-B1 deficiency leads to abnormal visual pathways in mice, it leaves the human visual system, apart from deficits in binocular vision, largely normal.
25779027 T cells from rheumatoid arthritis (RA) patients expressed higher EFNB1 mRNA levels, which correlated with RA symptoms and laboratory findings. Expression of EFNB1 in T cells might be a parameter for monitoring RA disease activity and treatment responses.
25643922 EphB2/ephrin-B1 were invoked in dental pulp stem cells with TNF-alpha treatment via the JNK-dependent pathway, but not NF-kB, p38 MAPK or MEK signalling.
25486017 we report a family with a G151S mutation in the EFNB1 gene. The mutation was identified in two severely affected sisters and paradoxically in their clinically unaffected father.
25436983 that EphrinB1 (EFNB1) co-localizes with microtubules (MTs) during all phases of the cell cycle.
25258252 Results indicate that EphrinB1 is uniquely dysregulated in medulloblastoma and promotes oncogenic responses in medulloblastoma cells, implicating ephrinB1 as a potential target
24825906 CNK1 mediates ephrinB1 signaling that promotes cell migration through RhoA and JNK activity.
24281372 Patients with EFNB1 mutations have a clear phenotype. This study will facilitate genetic counseling of parents and patients, and contribute to the diagnostic and screening process of patients with suspected CFNS.
24240587 EphrinB1 expression is related to the metastasis of breast cancer and its enhanced expression confers a poor prognosis, suggesting that EphrinB1 may be a relevant therapeutic target in breast cancers.
23811940 High EFNB1 expression is associated with squamous cell carcinomas of the head and neck.
More...

AA Sequence

MARPGQRWLGKWLVAMVVWALCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAG      1 - 70
RPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNG     71 - 140
SLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHE    141 - 210
TVNQEEKSGPGASGGSSGDPDGFFNSKVALFAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAAL    211 - 280
SLSTLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV        281 - 346
//

Text Mined References (75)

PMID Year Title
26580852 2015 Visual Pathways in Humans With Ephrin-B1 Deficiency Associated With the Cranio-Fronto-Nasal Syndrome.
25779027 2015 Role of EFNB1 and EFNB2 in Mouse Collagen-Induced Arthritis and Human Rheumatoid Arthritis.
25643922 2015 Stimulation of EphB2/ephrin-B1 signalling by tumour necrosis factor alpha in human dental pulp stem cells.
25486017 2015 Report of a family with craniofrontonasal syndrome.
25436983 2015 EphrinB1: novel microtubule associated protein whose expression affects taxane sensitivity.
25258252 2015 EphrinB1 expression is dysregulated and promotes oncogenic signaling in medulloblastoma.
24825906 2014 EphrinB1 interacts with CNK1 and promotes cell migration through c-Jun N-terminal kinase (JNK) activation.
24281372 2014 Phenotypes of craniofrontonasal syndrome in patients with a pathogenic mutation in EFNB1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24240587 2013 Enhanced expression of EphrinB1 is associated with lymph node metastasis and poor prognosis in breast cancer.
More...