Property Summary

NCBI Gene PubMed Count 386
Grant Count 396
R01 Count 288
Funding $44,106,439.7
PubMed Score 1302.67
PubTator Score 928.95

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P98170 D3DTF2 Q9NQ14
Symbols API3
ILP1
MIHA
XLP2
BIRC4
IAP-3
hIAP3
hIAP-3

Gene

PANTHER Protein Class (2)

PDB

1I3O   3UW4   1C9Q   1F9X   1G3F   1G73   1I4O   1I51   1KMC   1NW9   1TFQ   1TFT   2ECG   2JK7   2KNA   2OPY   2OPZ   2POI   2POP   2QRA   2VSL   3CLX   3CM2   3CM7   3EYL   3G76   3HL5   3UW5   4EC4   4HY0   4IC2   4IC3   4J3Y   4J44   4J45   4J46   4J47   4J48   4KJU   4KJV   4KMP   4MTZ   4OXC   4WVS   4WVT   4WVU   5C0K   5C0L   5C3H   5C3K   5C7A   5C7B   5C7C   5C7D   5C83   5C84  

Gene RIF (331)

PMID Text
27048361 This paper highlights that targeting the BMP and TGFbeta type I and type II receptors causes a downregulation of XIAP, TAK1, and Id1 leading to cell death of lung cancer cells.
26716649 High XIAP expression is associated with Pancreatic cancer.
26707189 Treatment of isolinderalactone increased the protein level of SCOS3, decreased phosphorylation of the STAT3 and suppressed expression of the down-stream genes of the X-linked inhibitor of apoptosis protein
26676658 we identified miR-215 as a potential tumor suppressor in patients with EOC downregulating expression of the oncogenic regulator XIAP
26507126 Tumor expression of XIAP helps to identify prostate cancer patients at risk of progression.
26404623 Overexpression of FOXM1, XIAP, and Survivin contributes to the development of drug-resistance and is associated with poor clinical outcome in breast cancer patients.
26314849 AZD5582 draws Mcl-1 down-regulation for induction of apoptosis through targeting of cIAP1 and XIAP in human pancreatic cancer
26313705 XIAP plays a critical role in the control of cytokine-induced cell death by Sestrin2.
26182687 Patients carrying the Glu349del mutation in the XIAP gene may have a clinically and immunologically distinct phenotype from patients with other XIAP mutations. The Glu349del mutation may be associated with dysgammaglobulinemia.
26172506 Data indicate that calpain is responsible for processing translation termination factor eRF3 into its IAP-binding isoform p-eRF3.
More...

AA Sequence

MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDTVRCFSCHAAV      1 - 70
DRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENYLGSRDHFALDRPSETHADYL     71 - 140
LRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQCFCCGGKLKNW    141 - 210
EPCDRAWSEHRRHFPNCFFVLGRNLNIRSESDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVN    211 - 280
KEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEE    281 - 350
CLVRTTEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKD    351 - 420
SMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITF    421 - 490
KQKIFMS                                                                   491 - 497
//

Text Mined References (395)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
27048361 2016 Inhibition of BMP and of TGF? receptors downregulates expression of XIAP and TAK1 leading to lung cancer cell death.
26716649 2016 Simultaneous gene silencing of KRAS and anti-apoptotic genes as a multitarget therapy.
26707189 2016 Isolinderalactone enhances the inhibition of SOCS3 on STAT3 activity by decreasing miR-30c in breast cancer.
26676658 2016 miR-215 functions as a tumor suppressor in epithelial ovarian cancer through regulation of the X-chromosome-linked inhibitor of apoptosis.
26507126 2015 Prognostic value of inhibitors of apoptosis proteins (IAPs) and caspases in prostate cancer: caspase-3 forms and XIAP predict biochemical progression after radical prostatectomy.
26404623 2015 FOXM1 targets XIAP and Survivin to modulate breast cancer survival and chemoresistance.
26314849 2015 A novel small-molecule IAP antagonist, AZD5582, draws Mcl-1 down-regulation for induction of apoptosis through targeting of cIAP1 and XIAP in human pancreatic cancer.
26313705 2015 Sestrin2 facilitates death receptor-induced apoptosis in lung adenocarcinoma cells through regulation of XIAP degradation.
26182687 2015 Dysgammaglobulinemia Associated With Glu349del, a Hypomorphic XIAP Mutation.
More...