Property Summary

NCBI Gene PubMed Count 112
PubMed Score 484.29
PubTator Score 246.78

Knowledge Summary


No data available


  Differential Expression (11)

Disease log2 FC p
nephrosclerosis -1.096 0.026
atypical teratoid / rhabdoid tumor 1.400 0.002
non-small cell lung cancer -1.398 0.000
lung cancer -1.700 0.010
lung adenocarcinoma -1.300 0.000
subependymal giant cell astrocytoma -1.068 0.037
Pick disease -1.200 0.027
progressive supranuclear palsy -1.500 0.038
Breast cancer -2.300 0.001
ovarian cancer -4.400 0.000
psoriasis -1.700 0.000


Accession P98164 O00711 Q16215 LRP-2
Symbols DBS




  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA Inparanoid

 CSPA Cell Line (2)

Gene RIF (57)

26529358 homozygous Asp3779Asn and a hemizygous Ile262Met mutations in the LRP2 and TSPYL2 genes, respectively, in a Pakistani family with two boys affected with mild nonsyndromic intellectual disability
26439398 Loss of LRP2 is associated with buphthalmos
26147675 we are the first to identify the association between LRP2 and gout in a Chinese population and to confirm this association in Asians.
25682901 Two novel LRP2 mutations, a homozygous nonsense mutation and a missense mutation in two unrealted families with Donnai-Barrow syndrome.
25585665 melanoma cell expression of LRP2/megalin significantly decreases melanoma cell proliferation and survival rates.
25502002 levels of urinary C-megalin are associated with histological abnormalities in adult IgAN patients
25304941 The megalin expression appears to vary inversely with gestational age with the greatest expression noted in the most premature samples. Age-dependent differences in placental megalin may therefore influence fetal exposure.
24876117 LRP2 sequencing reveals multiple rare variants associated with urinary trefoil factor-3
24366390 Serum uric acid-related gene LRP2 is not involved in gout susceptibility.
24286387 Association of the T-allele of a single nucleotide polymorphism in LRP2 with gout risk in the Maori and Pacific subjects was consistent with this allele increasing serum urate in Japanese individuals

AA Sequence

AKPKPPSRRDPTPTYSATEDTFKDTANLVKEDSEV                                      4621 - 4655

Text Mined References (113)

PMID Year Title
26529358 2016 Identification of a homozygous missense mutation in LRP2 and a hemizygous missense mutation in TSPYL2 in a family with mild intellectual disability.
26439398 2015 LRP2 Acts as SHH Clearance Receptor to Protect the Retinal Margin from Mitogenic Stimuli.
26147675 2015 Common Variants in LRP2 and COMT Genes Affect the Susceptibility of Gout in a Chinese Population.
25682901 2015 Variable expression pattern in Donnai-Barrow syndrome: Report of two novel LRP2 mutations and review of the literature.
25585665 2015 Melanoma tumors frequently acquire LRP2/megalin expression, which modulates melanoma cell proliferation and survival rates.
25502002 2014 Significance of urinary full-length megalin in patients with IgA nephropathy.
25304941 Megalin expression in human term and preterm placental villous tissues: effect of gestational age and sample processing and storage time.
25189868 2015 Gene-smoking interactions identify several novel blood pressure loci in the Framingham Heart Study.
24876117 2014 Sequencing of LRP2 reveals multiple rare variants associated with urinary trefoil factor-3.
24366390 2014 Common variants of a urate-associated gene LRP2 are not associated with gout susceptibility.