Property Summary

NCBI Gene PubMed Count 92
PubMed Score 260.34
PubTator Score 179.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Autistic Disorder 364 0.0 0.0
Dysequilibrium syndrome 4 0.0 0.0
Obesity 678 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (21)

Disease log2 FC p
acute quadriplegic myopathy -1.295 9.8e-04
astrocytic glioma -1.300 1.7e-02
breast carcinoma -2.100 2.9e-06
ductal carcinoma in situ -1.700 4.5e-03
esophageal adenocarcinoma -1.600 1.8e-02
fibroadenoma -1.500 3.5e-02
group 3 medulloblastoma -1.800 3.8e-04
intraductal papillary-mucinous adenoma (... -2.900 2.9e-05
intraductal papillary-mucinous carcinoma... -2.600 2.1e-03
intraductal papillary-mucinous neoplasm ... -1.600 1.5e-02
invasive ductal carcinoma -2.400 4.0e-02
lung cancer -3.100 3.2e-06
malignant mesothelioma -1.300 1.0e-06
medulloblastoma, large-cell -1.600 8.5e-03
ovarian cancer -2.600 2.4e-07
pancreatic cancer -1.100 1.0e-03
Pick disease -1.100 8.2e-03
posterior fossa group B ependymoma -1.100 1.2e-02
psoriasis 1.100 1.0e-02
spina bifida -1.929 4.2e-02
ulcerative colitis -1.073 3.0e-02

Protein-protein Interaction (4)

Gene RIF (62)

AA Sequence

MGTSALWALWLLLALCWAPRESGATGTGRKAKCEPSQFQCTNGRCITLLWKCDGDEDCVDGSDEKNCVKK      1 - 70
TCAESDFVCNNGQCVPSRWKCDGDPDCEDGSDESPEQCHMRTCRIHEISCGAHSTQCIPVSWRCDGENDC     71 - 140
DSGEDEENCGNITCSPDEFTCSSGRCISRNFVCNGQDDCSDGSDELDCAPPTCGAHEFQCSTSSCIPISW    141 - 210
VCDDDADCSDQSDESLEQCGRQPVIHTKCPASEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRTCRP    211 - 280
DQFECEDGSCIHGSRQCNGIRDCVDGSDEVNCKNVNQCLGPGKFKCRSGECIDISKVCNQEQDCRDWSDE    281 - 350
PLKECHINECLVNNGGCSHICKDLVIGYECDCAAGFELIDRKTCGDIDECQNPGICSQICINLKGGYKCE    351 - 420
CSRGYQMDLATGVCKAVGKEPSLIFTNRRDIRKIGLERKEYIQLVEQLRNTVALDADIAAQKLFWADLSQ    421 - 490
KAIFSASIDDKVGRHVKMIDNVYNPAAIAVDWVYKTIYWTDAASKTISVATLDGTKRKFLFNSDLREPAS    491 - 560
IAVDPLSGFVYWSDWGEPAKIEKAGMNGFDRRPLVTADIQWPNGITLDLIKSRLYWLDSKLHMLSSVDLN    561 - 630
GQDRRIVLKSLEFLAHPLALTIFEDRVYWIDGENEAVYGANKFTGSELATLVNNLNDAQDIIVYHELVQP    631 - 700
SGKNWCEEDMENGGCEYLCLPAPQINDHSPKYTCSCPSGYNVEENGRDCQSTATTVTYSETKDTNTTEIS    701 - 770
ATSGLVPGGINVTTAVSEVSVPPKGTSAAWAILPLLLLVMAAVGGYLMWRNWQHKNMKSMNFDNPVYLKT    771 - 840
TEEDLSIDIGRHSASVGHTYPAISVVSTDDDLA                                         841 - 873
//

Text Mined References (93)

PMID Year Title