Property Summary

NCBI Gene PubMed Count 84
Grant Count 110
R01 Count 69
Funding $12,353,659.99
PubMed Score 250.18
PubTator Score 179.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Synonym

Accession P98155 B2RMZ7 D3DRH6 Q5VVF6 VLDL receptor
Symbols CAMRQ1
CARMQ1
CHRMQ1
VLDL-R
VLDLRCH

Gene

PDB

1V9U   3DPR  

Gene RIF (56)

PMID Text
26699506 these results suggest that VLDLR functions in vivo as an HCV receptor independent of canonical CD81-mediated HCV entry.
26153297 the results obtained indicate that minimal fibrin-binding structures are located within the second and third CR domains of the VLDL receptor and the presence of the fourth CR domain is required for high-affinity binding
24903309 these results suggested that the miR-135a-VLDLR-p38 axis may contribute to gallbladder cancer cell proliferation
24844606 The results of this study demonstrated the presence of reelin, its receptors VLDLR and ApoER2 as well as Dab1 in the ENS and might indicate a novel role of the reelin system in regulating neuronal plasticity and pre-synaptic functions in the ENS.
24733846 these results identify a novel role for the VLDLR as a negative regulator of DC-mediated adaptive immune responses in HDM-induced allergic airway inflammation.
24662412 These results for the first time demonstrated that SalA protected against IS/RP-induced endothelial barrier dysfunction through suppression of VLDL receptor expression
24076391 ectopic expression of HIC1 in U2OS and MDA-MB-231 cell lines decreases expression of the ApoER2 and VLDLR genes, encoding two canonical tyrosine kinase receptors for Reelin.
23813796 study identified a novel homozygous VLDLR c.2248C>T mutation (p.Q750X) and distinctive MRI findings in 2 siblings with ataxia; also marked vitamin E deficiency was detected in the proband
23811271 These results conclude that in the hypoxic hearts of mice and men, the VLDLr gene is regulated by a direct binding of Hif-1alpha to the VLDLr promoter
23701949 Stx5 might play a role in modulating VLDL-R physiology by participating in an abrasively described or completely novel Golgi-bypass pathway.
More...

AA Sequence

MGTSALWALWLLLALCWAPRESGATGTGRKAKCEPSQFQCTNGRCITLLWKCDGDEDCVDGSDEKNCVKK      1 - 70
TCAESDFVCNNGQCVPSRWKCDGDPDCEDGSDESPEQCHMRTCRIHEISCGAHSTQCIPVSWRCDGENDC     71 - 140
DSGEDEENCGNITCSPDEFTCSSGRCISRNFVCNGQDDCSDGSDELDCAPPTCGAHEFQCSTSSCIPISW    141 - 210
VCDDDADCSDQSDESLEQCGRQPVIHTKCPASEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRTCRP    211 - 280
DQFECEDGSCIHGSRQCNGIRDCVDGSDEVNCKNVNQCLGPGKFKCRSGECIDISKVCNQEQDCRDWSDE    281 - 350
PLKECHINECLVNNGGCSHICKDLVIGYECDCAAGFELIDRKTCGDIDECQNPGICSQICINLKGGYKCE    351 - 420
CSRGYQMDLATGVCKAVGKEPSLIFTNRRDIRKIGLERKEYIQLVEQLRNTVALDADIAAQKLFWADLSQ    421 - 490
KAIFSASIDDKVGRHVKMIDNVYNPAAIAVDWVYKTIYWTDAASKTISVATLDGTKRKFLFNSDLREPAS    491 - 560
IAVDPLSGFVYWSDWGEPAKIEKAGMNGFDRRPLVTADIQWPNGITLDLIKSRLYWLDSKLHMLSSVDLN    561 - 630
GQDRRIVLKSLEFLAHPLALTIFEDRVYWIDGENEAVYGANKFTGSELATLVNNLNDAQDIIVYHELVQP    631 - 700
SGKNWCEEDMENGGCEYLCLPAPQINDHSPKYTCSCPSGYNVEENGRDCQSTATTVTYSETKDTNTTEIS    701 - 770
ATSGLVPGGINVTTAVSEVSVPPKGTSAAWAILPLLLLVMAAVGGYLMWRNWQHKNMKSMNFDNPVYLKT    771 - 840
TEEDLSIDIGRHSASVGHTYPAISVVSTDDDLA                                         841 - 873
//

Text Mined References (85)

PMID Year Title
26699506 2016 Hepatitis C virus utilizes VLDLR as a novel entry pathway.
26153297 2015 Interaction of Fibrin with the Very Low Density Lipoprotein Receptor: Further Characterization and Localization of the Fibrin-Binding Site.
24903309 2014 MicroRNA-135a acts as a putative tumor suppressor by directly targeting very low density lipoprotein receptor in human gallbladder cancer.
24844606 2014 Expression and regulation of reelin and its receptors in the enteric nervous system.
24733846 2014 The very low density lipoprotein receptor attenuates house dust mite-induced airway inflammation by suppressing dendritic cell-mediated adaptive immune responses.
24662412 2014 SalA attenuates ischemia/reperfusion-induced endothelial barrier dysfunction via down-regulation of VLDL receptor expression.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24076391 2013 The Reelin receptors ApoER2 and VLDLR are direct target genes of HIC1 (Hypermethylated In Cancer 1).
23813796 2013 Mutations in VLDLR associated with ataxia with secondary vitamin E deficiency.
23811271 2013 Hypoxia-induced regulation of the very low density lipoprotein receptor.
More...