Property Summary

NCBI Gene PubMed Count 19
Grant Count 41
R01 Count 2
Funding $12,831,818.84
PubMed Score 6.77
PubTator Score 35.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.306 0.000
medulloblastoma, large-cell -1.200 0.000

Gene RIF (5)

PMID Text
22465717 DGCR2, GPR44 and SerpinB10, found in beta cells, were negative in all other cell types within pancreas and exposed epitopes at the cell surface
19668116 These data do not support a significant role of DGCR2 in the aetiology of schizophrenia in the German population.
19668116 Observational study of gene-disease association. (HuGE Navigator)
18797402 Observational study of gene-disease association. (HuGE Navigator)
16783572 Study confirmed the association between DGCR2 & schizophrenia through genotyping of 1,400 subjects; in a gene expression analysis, the risk allele of a coding SNP associated with schizophrenia was found to be associated with a reduced expression of DGCR2.

AA Sequence

MVPKADSGAFLLLFLLVLTVTEPLRPELRCNPGQFACRSGTIQCIPLPWQCDGWATCEDESDEANCPEVT      1 - 70
GEVRPHHGKEAVDPRQGRARGGDPSHFHAVNVAQPVRFSSFLGKCPTGWHHYEGTASCYRVYLSGENYWD     71 - 140
AAQTCQRLNGSLATFSTDQELRFVLAQEWDQPERSFGWKDQRKLWVGYQYVITGRNRSLEGRWEVAFKGS    141 - 210
SEVFLPPDPIFASAMSENDNVFCAQLQCFHFPTLRHHDLHSWHAESCYEKSSFLCKRSQTCVDIKDNVVD    211 - 280
EGFYFTPKGDDPCLSCTCHGGEPEMCVAALCERPQGCQQYRKDPKECCKFMCLDPDGNSLFDSMASGMRL    281 - 350
VVSCISSFLILSLLLFMVHRLRQRRRERIESLIGANLHHFNLGRRIPGFDYGPDGFGTGLTPLHLSDDGE    351 - 420
GGTFHFHDPPPPYTAYKYPDIGQPDDPPPPYEASIHPDSVFYDPADDDAFEPVEVSLPAPGDGGSEGALL    421 - 490
RRLEQPLPTAGASLADLEDSADSSSALLVPPDPAQSGSTPAAEALPGGGRHSRSSLNTVV              491 - 550
//

Text Mined References (22)

PMID Year Title
23227193 2012 Analysis of copy number variation in Alzheimer's disease in a cohort of clinically characterized and neuropathologically verified individuals.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22465717 2012 Novel pancreatic beta cell-specific proteins: antibody-based proteomics for identification of new biomarker candidates.
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
19906316 2009 Discovery of novel human transcript variants by analysis of intronic single-block EST with polyadenylation site.
19668116 2009 No association between genetic variants at the DGCR2 gene and schizophrenia in a German sample.
18797402 2008 Replication study for associations between polymorphisms in the CLDN5 and DGCR2 genes in the 22q11 deletion syndrome region and schizophrenia.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16783572 2006 A complete genetic association scan of the 22q11 deletion region and functional evidence reveal an association between DGCR2 and schizophrenia.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...