Property Summary

NCBI Gene PubMed Count 36
Grant Count 14
R01 Count 10
Funding $952,590.52
PubMed Score 51.18
PubTator Score 39.29

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
24692557 levels of fibulin 2 dramatically increased in the retinal pigment epithelium following retinal detachment, suggesting a direct role for fibulin 2 in the re-attachment of the retina to the retinal pigment epithelium.
23612897 Study identified and validated a novel bona fide target of miR-1, Fibullin-2 (Fbln2), a secreted protein implicated in extracellular matrix remodeling.
22912785 Two variants in the fibulin2 gene are associated with lower systolic blood pressure and decreased risk of hypertension.
21743496 Data provide evidence that FBLN2 short isoform (FBLN2S) has an important tumor-suppressive and anti-angiogenic role in nasopharyngeal carcinoma (NPC).
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20083228 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19834535 Observational study of gene-disease association. (HuGE Navigator)
19609566 fibulin-1 and -2 respond differentially to single and repeated damaging noxae, and their expression is differently present in liver cells

AA Sequence

MVLLWEPAGAWLALGLALALGPSVAAAAPRQDCTGVECPPLENCIEEALEPGACCATCVQQGCACEGYQY      1 - 70
YDCLQGGFVRGRVPAGQSYFVDFGSTECSCPPGGGKISCQFMLCPELPPNCIEAVVVADSCPQCGQVGCV     71 - 140
HAGHKYAAGHTVHLPPCRACHCPDAGGELICYQLPGCHGNFSDAEEGDPERHYEDPYSYDQEVAEVEAAT    141 - 210
ALGGEVQAGAVQAGAGGPPAALGGGSQPLSTIQAPPWPAVLPRPTAAAALGPPAPVQAKARRVTEDSEEE    211 - 280
EEEEEEREEMAVTEQLAAGGHRGLDGLPTTAPAGPSLPIQEERAEAGARAEAGARPEENLILDAQATSRS    281 - 350
TGPEGVTHAPSLGKAALVPTQAVPGSPRDPVKPSPHNILSTSLPDAAWIPPTREVPRKPQVLPHSHVEED    351 - 420
TDPNSVHSIPRSSPEGSTKDLIETCCAAGQQWAIDNDECLEIPESGTEDNVCRTAQRHCCVSYLQEKSCM    421 - 490
AGVLGAKEGETCGAEDNDSCGISLYKQCCDCCGLGLRVRAEGQSCESNPNLGYPCNHVMLSCCEGEEPLI    491 - 560
VPEVRRPPEPAAAPRRVSEAEMAGREALSLGTEAELPNSLPGDDQDECLLLPGELCQHLCINTVGSYHCA    561 - 630
CFPGFSLQDDGRTCRPEGHPPQPEAPQEPALKSEFSQVASNTIPLPLPQPNTCKDNGPCKQVCSTVGGSA    631 - 700
ICSCFPGYAIMADGVSCEDINECVTDLHTCSRGEHCVNTLGSFHCYKALTCEPGYALKDGECEDVDECAM    701 - 770
GTHTCQPGFLCQNTKGSFYCQARQRCMDGFLQDPEGNCVDINECTSLSEPCRPGFSCINTVGSYTCQRNP    771 - 840
LICARGYHASDDGTKCVDVNECETGVHRCGEGQVCHNLPGSYRCDCKAGFQRDAFGRGCIDVNECWASPG    841 - 910
RLCQHTCENTLGSYRCSCASGFLLAADGKRCEDVNECEAQRCSQECANIYGSYQCYCRQGYQLAEDGHTC    911 - 980
TDIDECAQGAGILCTFRCLNVPGSYQCACPEQGYTMTANGRSCKDVDECALGTHNCSEAETCHNIQGSFR    981 - 1050
CLRFECPPNYVQVSKTKCERTTCHDFLECQNSPARITHYQLNFQTGLLVPAHIFRIGPAPAFTGDTIALN   1051 - 1120
IIKGNEEGYFGTRRLNAYTGVVYLQRAVLEPRDFALDVEMKLWRQGSVTTFLAKMHIFFTTFAL         1121 - 1184
//

Text Mined References (41)

PMID Year Title
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24692557 2014 Fibulin 2, a tyrosine O-sulfated protein, is up-regulated following retinal detachment.
23658023 2013 Comparative proteomic analysis of supportive and unsupportive extracellular matrix substrates for human embryonic stem cell maintenance.
23612897 2013 Therapeutic cardiac-targeted delivery of miR-1 reverses pressure overload-induced cardiac hypertrophy and attenuates pathological remodeling.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23092984 2012 Genome-wide association of mood-incongruent psychotic bipolar disorder.
22912785 2012 Two variants in the fibulin2 gene are associated with lower systolic blood pressure and decreased risk of hypertension.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
21743496 2012 Anti-angiogenic and tumor-suppressive roles of candidate tumor-suppressor gene, Fibulin-2, in nasopharyngeal carcinoma.
More...