Property Summary

NCBI Gene PubMed Count 102
Grant Count 149
R01 Count 126
Funding $16,098,432.1
PubMed Score 174.63
PubTator Score 110.27

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P98082 A6NES5 Q13598 Q9BTY0 Q9UK04
Symbols DOC2
DOC-2

Gene

PANTHER Protein Class (1)

PDB

2LSW  

Gene RIF (64)

PMID Text
26927671 these findings reveal that DAB2 is critical for controlling inflammatory signaling during phenotypic polarization of macrophages
26769181 Data show that miR106b was frequently up-regulated in human cervical carcinoma tumors and cell lines and inversely correlated with DAB2 expression. Its regulation in under TGF-beta1 which contributes to cell migration by targeting DAB2 in cervical carcinoma.
26755607 inhibition of WNT/beta-catenin signaling by DAB2 is essential for establishing the correct number of cardiomyocytes in the developing heart.
26143155 DAB2 regulated the cell migration associated genes in PC3 cells, and the differential DAB2 expression between LNCaP and PC3 cells was partly regulated by histone 4 acetylation.
25892549 These results indicated that miR-93 plays an important role in the initiation and progression of NPC by targeting Dab2 and the miR-93/Dab2 pathway may contribute to the development of novel therapeutic strategies for NPC in the future.
25879443 Dab2 depletion also increases the rescued protein half-life of DeltaF508 CFTR by ~18% and ~91%, respectively
25719979 DAB2 expression is decreased in Non-Small Cell Lung Cancer , and the frequent methylation event at sites -86 to 226 of the DAB2 gene could contribute to the downregulation of DAB2.
25496667 Genome-wide shRNA screening identifies DAB2, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
25331956 Numb specifically regulates NPC1L1-mediated cholesterol absorption both in human intestine and liver, distinct from ARH and Dab2, which selectively participate in LDLR-mediated LDL uptake.
25253241 Akt1 and Akt2 are involved in albumin endocytosis, and phosphorylation of Dab2 by Akt induces albumin endocytosis in proximal tubule epithelial cells.
More...

AA Sequence

MSNEVETSATNGQPDQQAAPKAPSKKEKKKGPEKTDEYLLARFKGDGVKYKAKLIGIDDVPDARGDKMSQ      1 - 70
DSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNKISFIARDVTDNRAFGYVCGG     71 - 140
EGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEEKKKIEEASKAVENGSEALMILDDQTNKLKSGV    141 - 210
DQMDLFGDMSTPPDLNSPTESKDILLVDLNSEIDTNQNSLRENPFLTNGITSCSLPRPTPQASFLPENAF    211 - 280
SANLNFFPTPNPDPFRDDPFTQPDQSTPSSFDSLKSPDQKKENSSSSSTPLSNGPLNGDVDYFGQQFDQI    281 - 350
SNRTGKQEAQAGPWPFSSSQTQPAVRTQNGVSEREQNGFSVKSSPNPFVGSPPKGLSIQNGVKQDLESSV    351 - 420
QSSPHDSIAIIPPPQSTKPGRGRRTAKSSANDLLASDIFAPPVSEPSGQASPTGQPTALQPNPLDLFKTS    421 - 490
APAPVGPLVGLGGVTVTLPQAGPWNTASLVFNQSPSMAPGAMMGGQPSGFSQPVIFGTSPAVSGWNQPSP    491 - 560
FAASTPPPVPVVWGPSASVAPNAWSTTSPLGNPFQSNIFPAPAVSTQPPSMHSSLLVTPPQPPPRAGPPK    561 - 630
DISSDAFTALDPLGDKEIKDVKEMFKDFQLRQPPAVPARKGEQTSSGTLSAFASYFNSKVGIPQENADHD    631 - 700
DFDANQLLNKINEPPKPAPRQVSLPVTKSTDNAFENPFFKDSFGSSQASVASSQPVSSEMYRDPFGNPFA    701 - 770
//

Text Mined References (111)

PMID Year Title
26927671 2016 Disabled homolog 2 controls macrophage phenotypic polarization and adipose tissue inflammation.
26769181 2016 MicroRNA-106b is involved in transforming growth factor ?1-induced cell migration by targeting disabled homolog 2 in cervical carcinoma.
26755607 2016 Quantitative proteomics identify DAB2 as a cardiac developmental regulator that inhibits WNT/?-catenin signaling.
26143155 2015 Disabled homolog 2 is required for migration and invasion of prostate cancer cells.
25892549 2015 MicroRNA-93 promotes cell growth and invasion in nasopharyngeal carcinoma by targeting disabled homolog-2.
25879443 2015 ?F508 CFTR surface stability is regulated by DAB2 and CHIP-mediated ubiquitination in post-endocytic compartments.
25719979 2015 Aberrant Hypermethylation at Sites -86 to 226 of DAB2 Gene in Non-Small Cell Lung Cancer.
25331956 2014 The clathrin adaptor proteins ARH, Dab2, and numb play distinct roles in Niemann-Pick C1-Like 1 versus low density lipoprotein receptor-mediated cholesterol uptake.
25253241 2014 Akt recruits Dab2 to albumin endocytosis in the proximal tubule.
24889971 2014 Distinct effects of Disabled-2 on transferrin uptake in different cell types and culture conditions.
More...