Property Summary

NCBI Gene PubMed Count 16
PubMed Score 293.44
PubTator Score 271.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
group 4 medulloblastoma -1.400 4.4e-04
intraductal papillary-mucinous carcinoma... -1.200 2.7e-02
medulloblastoma, large-cell -1.700 4.9e-04
ovarian cancer -1.200 1.2e-05
posterior fossa group B ependymoma -1.100 6.0e-05
psoriasis -1.100 5.9e-25

 MGI Phenotype (1)

 GWAS Trait (1)

Gene RIF (5)

AA Sequence

MTQGPGGRAPPAPPAPPEPEAPTTFCALLPRMPQWKFAAPGGFLGRGPAAARAAGASGGADPQPEPAGPG      1 - 70
GVPALAAAVLGACEPRCAAPCPLPALSRCRGAGSRGSRGGRGAAGSGDAAAAAEWIRKGSFIHKPAHGWL     71 - 140
HPDARVLGPGVSYVVRYMGCIEVLRSMRSLDFNTRTQVTREAINRLHEAVPGVRGSWKKKAPNKALASVL    141 - 210
GKSNLRFAGMSISIHISTDGLSLSVPATRQVIANHHMPSISFASGGDTDMTDYVAYVAKDPINQRACHIL    211 - 280
ECCEGLAQSIISTVGQAFELRFKQYLHSPPKVALPPERLAGPEESAWGDEEDSLEHNYYNSIPGKEPPLG    281 - 350
GLVDSRLALTQPCALTALDQGPSPSLRDACSLPWDVGSTGTAPPGDGYVQADARGPPDHEEHLYVNTQGL    351 - 420
DAPEPEDSPKKDLFDMRPFEDALKLHECSVAAGVTAAPLPLEDQWPSPPTRRAPVAPTEEQLRQEPWYHG    421 - 490
RMSRRAAERMLRADGDFLVRDSVTNPGQYVLTGMHAGQPKHLLLVDPEGVVRTKDVLFESISHLIDHHLQ    491 - 560
NGQPIVAAESELHLRGVVSREP                                                    561 - 582
//

Text Mined References (17)

PMID Year Title