Property Summary

NCBI Gene PubMed Count 16
Grant Count 11
R01 Count 9
Funding $1,680,249.96
PubMed Score 272.60
PubTator Score 271.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
medulloblastoma, large-cell -1.700 0.000
intraductal papillary-mucinous carcinoma... -1.200 0.027
group 4 medulloblastoma -1.400 0.000
posterior fossa group B ependymoma -1.100 0.000
ovarian cancer -1.200 0.000
psoriasis -1.100 0.000

Gene RIF (5)

PMID Text
25613377 Sck was identified as a novel molecule indispensable for CD95's activation of the PI3K and MAPK pathways and induction of cell cycle progression in pancreatic ductal adenocarcinoma.
24170347 SHC2 gene deletions underlie few, if any, cases of well-characterized multiple system atrophy in the US population.
21658278 Data show that copy number loss of SHC2 strongly indicates a causal link to multiple system atrophy.
16436505 HIV-1 Tat-induced small GTPase Ras activation is mediated by tyrosine phosphorylation of Shc and recruitment of Grb2 in human endothelial cells
9325171 HIV-1 Tat-induced small GTPase Ras activation is mediated by tyrosine phosphorylation of Shc and recruitment of Grb2 in human endothelial cells

AA Sequence

MTQGPGGRAPPAPPAPPEPEAPTTFCALLPRMPQWKFAAPGGFLGRGPAAARAAGASGGADPQPEPAGPG      1 - 70
GVPALAAAVLGACEPRCAAPCPLPALSRCRGAGSRGSRGGRGAAGSGDAAAAAEWIRKGSFIHKPAHGWL     71 - 140
HPDARVLGPGVSYVVRYMGCIEVLRSMRSLDFNTRTQVTREAINRLHEAVPGVRGSWKKKAPNKALASVL    141 - 210
GKSNLRFAGMSISIHISTDGLSLSVPATRQVIANHHMPSISFASGGDTDMTDYVAYVAKDPINQRACHIL    211 - 280
ECCEGLAQSIISTVGQAFELRFKQYLHSPPKVALPPERLAGPEESAWGDEEDSLEHNYYNSIPGKEPPLG    281 - 350
GLVDSRLALTQPCALTALDQGPSPSLRDACSLPWDVGSTGTAPPGDGYVQADARGPPDHEEHLYVNTQGL    351 - 420
DAPEPEDSPKKDLFDMRPFEDALKLHECSVAAGVTAAPLPLEDQWPSPPTRRAPVAPTEEQLRQEPWYHG    421 - 490
RMSRRAAERMLRADGDFLVRDSVTNPGQYVLTGMHAGQPKHLLLVDPEGVVRTKDVLFESISHLIDHHLQ    491 - 560
NGQPIVAAESELHLRGVVSREP                                                    561 - 582
//

Text Mined References (17)

PMID Year Title
25613377 2015 CD95 promotes metastatic spread via Sck in pancreatic ductal adenocarcinoma.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24170347 2014 SHC2 gene copy number in multiple system atrophy (MSA).
21658278 2011 Copy number loss of (src homology 2 domain containing)-transforming protein 2 (SHC2) gene: discordant loss in monozygotic twins and frequent loss in patients with multiple system atrophy.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16368877 2006 Genomic annotation of 15,809 ESTs identified from pooled early gestation human eyes.
16273093 2006 A quantitative protein interaction network for the ErbB receptors using protein microarrays.
15851471 2005 Platelet endothelial aggregation receptor 1 (PEAR1), a novel epidermal growth factor repeat-containing transmembrane receptor, participates in platelet contact-induced activation.
15513915 2005 Neurotrophin-dependent tyrosine phosphorylation of Ras guanine-releasing factor 1 and associated neurite outgrowth is dependent on the HIKE domain of TrkA.
15057824 2004 The DNA sequence and biology of human chromosome 19.
More...