Property Summary

NCBI Gene PubMed Count 16
PubMed Score 293.44
PubTator Score 271.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
group 4 medulloblastoma -1.400 4.4e-04
intraductal papillary-mucinous carcinoma... -1.200 2.7e-02
medulloblastoma, large-cell -1.700 4.9e-04
ovarian cancer -1.200 1.2e-05
posterior fossa group B ependymoma -1.100 6.0e-05
psoriasis -1.100 5.9e-25

Synonym

Accession P98077 O60230 Q9NPL5 Q9UCX4
Symbols SCK
SLI
SHCB

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

 MGI Phenotype (1)

 GWAS Trait (1)

Gene RIF (5)

AA Sequence

MTQGPGGRAPPAPPAPPEPEAPTTFCALLPRMPQWKFAAPGGFLGRGPAAARAAGASGGADPQPEPAGPG      1 - 70
GVPALAAAVLGACEPRCAAPCPLPALSRCRGAGSRGSRGGRGAAGSGDAAAAAEWIRKGSFIHKPAHGWL     71 - 140
HPDARVLGPGVSYVVRYMGCIEVLRSMRSLDFNTRTQVTREAINRLHEAVPGVRGSWKKKAPNKALASVL    141 - 210
GKSNLRFAGMSISIHISTDGLSLSVPATRQVIANHHMPSISFASGGDTDMTDYVAYVAKDPINQRACHIL    211 - 280
ECCEGLAQSIISTVGQAFELRFKQYLHSPPKVALPPERLAGPEESAWGDEEDSLEHNYYNSIPGKEPPLG    281 - 350
GLVDSRLALTQPCALTALDQGPSPSLRDACSLPWDVGSTGTAPPGDGYVQADARGPPDHEEHLYVNTQGL    351 - 420
DAPEPEDSPKKDLFDMRPFEDALKLHECSVAAGVTAAPLPLEDQWPSPPTRRAPVAPTEEQLRQEPWYHG    421 - 490
RMSRRAAERMLRADGDFLVRDSVTNPGQYVLTGMHAGQPKHLLLVDPEGVVRTKDVLFESISHLIDHHLQ    491 - 560
NGQPIVAAESELHLRGVVSREP                                                    561 - 582
//

Text Mined References (17)

PMID Year Title