Property Summary

NCBI Gene PubMed Count 21
Grant Count 7
R01 Count 4
Funding $835,772
PubMed Score 569.58
PubTator Score 11.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
cystic fibrosis -1.375 0.003
medulloblastoma, large-cell 1.200 0.000
non primary Sjogren syndrome sicca -1.400 0.025

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
493169 confirmatory 130 / 126 / 617 CHOP2 Reporter Counterscreen Assay for Inhibitors of Ubiquitin-specific Protease USP2a

Gene RIF (9)

PMID Text
23436726 The Y174R variant showed improved specificities for substrates containing the sequences DDDDK (kcat/KM = 6.83 x 106 M-1 sec-1) and DDDDR (kcat/KM = 1.89 x 107 M-1 sec-1) relative to all other enteropeptidase variants reported to date.
23185382 Enteropeptidase is a gene associated with a starvation human phenotype and a novel target for obesity treatment
22571433 Characterization of the different catalytic activity of human and bovine enteropeptidase light chains toward hydrolysis of peptides and proteins lacking tetraaspartate sequence.
22488687 Human enteropeptidase shows 10x faster kinetics compared to other animal sources but low solubility under low salt conditions. A supercharged variant of enteropeptidase light chain with increased solubility was used for crystallization.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19924134 Because mesotrypsin is resistant to naturally occurring trypsin inhibitors, confined expression of the isoforms of mesotrypsinogens and enteropeptidase may indicate that mesotrypsin is involved in keratinocyte terminal differentiation
18062964 Enterokinase directly cleaved proMMP-9 at the Lys65-Ser66 site.
12907431 Produced in enterocytes and goblet cells. Localization on brush border of cells for physiological activation of digestive enzymes. In duodenal polyps and adenocarcinoma at duodenum but not in Brunner's gland adenoma.
11913964 Engineered recombinant enteropeptidase catalytic subunit: effect of N-terminal modification

AA Sequence

MGSKRGISSRHHSLSSYEIMFAALFAILVVLCAGLIAVSCLTIKESQRGAALGQSHEARATFKITSGVTY      1 - 70
NPNLQDKLSVDFKVLAFDLQQMIDEIFLSSNLKNEYKNSRVLQFENGSIIVVFDLFFAQWVSDENVKEEL     71 - 140
IQGLEANKSSQLVTFHIDLNSVDILDKLTTTSHLATPGNVSIECLPGSSPCTDALTCIKADLFCDGEVNC    141 - 210
PDGSDEDNKMCATVCDGRFLLTGSSGSFQATHYPKPSETSVVCQWIIRVNQGLSIKLSFDDFNTYYTDIL    211 - 280
DIYEGVGSSKILRASIWETNPGTIRIFSNQVTATFLIESDESDYVGFNATYTAFNSSELNNYEKINCNFE    281 - 350
DGFCFWVQDLNDDNEWERIQGSTFSPFTGPNFDHTFGNASGFYISTPTGPGGRQERVGLLSLPLDPTLEP    351 - 420
ACLSFWYHMYGENVHKLSINISNDQNMEKTVFQKEGNYGDNWNYGQVTLNETVKFKVAFNAFKNKILSDI    421 - 490
ALDDISLTYGICNGSLYPEPTLVPTPPPELPTDCGGPFELWEPNTTFSSTNFPNSYPNLAFCVWILNAQK    491 - 560
GKNIQLHFQEFDLENINDVVEIRDGEEADSLLLAVYTGPGPVKDVFSTTNRMTVLLITNDVLARGGFKAN    561 - 630
FTTGYHLGIPEPCKADHFQCKNGECVPLVNLCDGHLHCEDGSDEADCVRFFNGTTNNNGLVRFRIQSIWH    631 - 700
TACAENWTTQISNDVCQLLGLGSGNSSKPIFPTDGGPFVKLNTAPDGHLILTPSQQCLQDSLIRLQCNHK    701 - 770
SCGKKLAAQDITPKIVGGSNAKEGAWPWVVGLYYGGRLLCGASLVSSDWLVSAAHCVYGRNLEPSKWTAI    771 - 840
LGLHMKSNLTSPQTVPRLIDEIVINPHYNRRRKDNDIAMMHLEFKVNYTDYIQPICLPEENQVFPPGRNC    841 - 910
SIAGWGTVVYQGTTANILQEADVPLLSNERCQQQMPEYNITENMICAGYEEGGIDSCQGDSGGPLMCQEN    911 - 980
NRWFLAGVTSFGYKCALPNRPGVYARVSRFTEWIQSFLH                                   981 - 1019
//

Text Mined References (21)

PMID Year Title
24407287 2014 Promyelocytic leukemia protein interacts with the apoptosis-associated speck-like protein to limit inflammasome activation.
23568457 2013 Genetic variants associated with disordered eating.
23436726 2013 Human enteropeptidase light chain: bioengineering of recombinants and kinetic investigations of structure and function.
23185382 2012 Enteropeptidase: a gene associated with a starvation human phenotype and a novel target for obesity treatment.
22571433 2012 Dissecting structural basis of the unique substrate selectivity of human enteropeptidase catalytic subunit.
22488687 2012 Crystal structure of a supercharged variant of the human enteropeptidase light chain.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19924134 2010 Keratinocytes synthesize enteropeptidase and multiple forms of trypsinogen during terminal differentiation.
18062964 2008 Intracellular co-localization of trypsin-2 and matrix metalloprotease-9: possible proteolytic cascade of trypsin-2, MMP-9 and enterokinase in carcinoma.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...