Property Summary

NCBI Gene PubMed Count 67
Grant Count 54
R01 Count 32
Funding $6,472,413.97
PubMed Score 168.79
PubTator Score 124.94

Knowledge Summary

Patent

No data available

Expression

Gene RIF (54)

PMID Text
27143355 The current study describes a novel mechanism linking the TSG-6 transfer of the newly described HC5 to the HA-dependent control of cell phenotype. The interaction of HC5 with cell surface HA was essential for TGFbeta1-dependent differentiation of fibroblasts to myofibroblasts, highlighting its importance as a novel potential therapeutic target.
26685054 Data postulate that the molecular cross-linking enhanced by the multiple binding modes of the Link module might be critical for remodeling the ECM during inflammation/ovulation and might contribute to other functions of TSG-6.
26468290 the well characterized hyaluronan-binding site in the TSG-6 Link module is not used for recognition during transfer of HCs onto HA.
25661977 TSG-6 exhibited anti-inflammatory effects during the wound healing process and cicatrization and significantly diminished hypertrophic scar formation in a rabbit ear model
25561734 Heavy chain transfer by tumor necrosis factor-stimulated gene 6 to the bikunin proteoglycan.
25329668 results suggest that systemic administration of hASC or TSG-6 may be novel approaches to reverse CS-induced myelosuppression.
25325979 TSG-6 activity in tissues, was examined.
24742347 HIV-1 gp120 upregulates the expression of tumor necrosis factor, alpha-induced protein 6 (TNFAIP6) in human B cells
24667918 HIV-1 gp120 upregulates the expression of tumor necrosis factor, alpha-induced protein 6 (TNFAIP6) in human B cells
24501198 TSG-6 suppresses CXCL8-mediated chemotaxis of neutrophils; this lower potency effect might be important at sites where there is high local expression of TSG-6.
More...

AA Sequence

MIILIYLFLLLWEDTQGWGFKDGIFHNSIWLERAAGVYHREARSGKYKLTYAEAKAVCEFEGGHLATYKQ      1 - 70
LEAARKIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGIRLNRSERWDAYCYNPHAKECGGVFT     71 - 140
DPKQIFKSPGFPNEYEDNQICYWHIRLKYGQRIHLSFLDFDLEDDPGCLADYVEIYDSYDDVHGFVGRYC    141 - 210
GDELPDDIISTGNVMTLKFLSDASVTAGGFQIKYVAMDPVSKSSQGKNTSTTSTGNKNFLAGRFSHL       211 - 277
//

Text Mined References (68)

PMID Year Title
27143355 2016 Tumor Necrosis Factor-stimulated Gene 6 (TSG-6)-mediated Interactions with the Inter-?-inhibitor Heavy Chain 5 Facilitate Tumor Growth Factor ?1 (TGF?1)-dependent Fibroblast to Myofibroblast Differentiation.
27044744 2016 The Anti-inflammatory Protein TSG-6 Regulates Chemokine Function by Inhibiting Chemokine/Glycosaminoglycan Interactions.
26685054 2016 Nuclear Magnetic Resonance Insight into the Multiple Glycosaminoglycan Binding Modes of the Link Module from Human TSG-6.
26468290 2015 Metal Ion-dependent Heavy Chain Transfer Activity of TSG-6 Mediates Assembly of the Cumulus-Oocyte Matrix.
25661977 2015 Anti-inflammatory cytokine TSG-6 inhibits hypertrophic scar formation in a rabbit ear model.
25561734 2015 Heavy chain transfer by tumor necrosis factor-stimulated gene 6 to the bikunin proteoglycan.
25329668 2015 Human adipose-derived stem cells ameliorate cigarette smoke-induced murine myelosuppression via secretion of TSG-6.
25325979 2015 Analysis of the heavy-chain modification and TSG-6 activity in pathological hyaluronan matrices.
24501198 2014 TSG-6 inhibits neutrophil migration via direct interaction with the chemokine CXCL8.
24403066 2014 A refined model for the TSG-6 link module in complex with hyaluronan: use of defined oligosaccharides to probe structure and function.
More...