Property Summary

NCBI Gene PubMed Count 67
PubMed Score 168.79
PubTator Score 124.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
malignant mesothelioma 3163 6.93719527298059E-9
juvenile dermatomyositis 1189 1.03661318432041E-6
interstitial cystitis 2299 1.23874429633947E-5
tuberculosis and treatment for 6 months 686 1.81354782699079E-5
lung cancer 4473 2.53289918333827E-5
nasopharyngeal carcinoma 1056 8.360788347863E-5
pancreatic carcinoma 567 1.77352139443296E-4
pancreatic cancer 2300 1.77352139443299E-4
ulcerative colitis 2087 3.32234950974758E-4
adult high grade glioma 2148 3.91482819920433E-4
hepatocellular carcinoma 550 6.0056244494957E-4
glioblastoma 5572 6.30457633792993E-4
pilocytic astrocytoma 3086 0.00193830772007311
head and neck cancer 270 0.00200881068078444
ovarian cancer 8492 0.00303034729075585
head and neck cancer and chronic obstructive pulmonary disease 237 0.00350466071208809
cystic fibrosis 1670 0.00513803827212357
Multiple Sclerosis 498 0.00956016795972869
X-linked cerebral adrenoleukodystrophy 115 0.0104561420160357
gastric carcinoma 832 0.0132088580265155
non diabetic and post-ischemic heart failure 200 0.0136332845010124
mucosa-associated lymphoid tissue lymphoma 480 0.0139741261828876
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0140123369643941
Rheumatoid Arthritis 1171 0.0157814652768182
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0171481519041518
oligodendroglioma 2849 0.0172552517875449
astrocytic glioma 2241 0.0200899381677707
invasive ductal carcinoma 2950 0.0227696953265298
Breast cancer 3099 0.0242437391459974
psoriasis 6685 0.030261294495032
primary pancreatic ductal adenocarcinoma 1271 0.0458963475087907
esophageal adenocarcinoma 737 0.0477657861267843
cutaneous lupus erythematosus 1056 0.0495417477801882
Disease Target Count Z-score Confidence
Arthritis 248 4.07 2.0
Ulceroglandular tularemia 2 3.796 1.9

Expression

Synonym

Accession P98066 Q53TI7 Q8WWI9
Symbols TSG6
TSG-6

Gene

PDB

1O7B   1O7C   2N40   2PF5   2WNO  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Gene RIF (54)

PMID Text
27143355 The current study describes a novel mechanism linking the TSG-6 transfer of the newly described HC5 to the HA-dependent control of cell phenotype. The interaction of HC5 with cell surface HA was essential for TGFbeta1-dependent differentiation of fibroblasts to myofibroblasts, highlighting its importance as a novel potential therapeutic target.
26685054 Data postulate that the molecular cross-linking enhanced by the multiple binding modes of the Link module might be critical for remodeling the ECM during inflammation/ovulation and might contribute to other functions of TSG-6.
26468290 the well characterized hyaluronan-binding site in the TSG-6 Link module is not used for recognition during transfer of HCs onto HA.
25661977 TSG-6 exhibited anti-inflammatory effects during the wound healing process and cicatrization and significantly diminished hypertrophic scar formation in a rabbit ear model
25561734 Heavy chain transfer by tumor necrosis factor-stimulated gene 6 to the bikunin proteoglycan.
25329668 results suggest that systemic administration of hASC or TSG-6 may be novel approaches to reverse CS-induced myelosuppression.
25325979 TSG-6 activity in tissues, was examined.
24742347 HIV-1 gp120 upregulates the expression of tumor necrosis factor, alpha-induced protein 6 (TNFAIP6) in human B cells
24667918 HIV-1 gp120 upregulates the expression of tumor necrosis factor, alpha-induced protein 6 (TNFAIP6) in human B cells
24501198 TSG-6 suppresses CXCL8-mediated chemotaxis of neutrophils; this lower potency effect might be important at sites where there is high local expression of TSG-6.
More...

AA Sequence

MIILIYLFLLLWEDTQGWGFKDGIFHNSIWLERAAGVYHREARSGKYKLTYAEAKAVCEFEGGHLATYKQ      1 - 70
LEAARKIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGIRLNRSERWDAYCYNPHAKECGGVFT     71 - 140
DPKQIFKSPGFPNEYEDNQICYWHIRLKYGQRIHLSFLDFDLEDDPGCLADYVEIYDSYDDVHGFVGRYC    141 - 210
GDELPDDIISTGNVMTLKFLSDASVTAGGFQIKYVAMDPVSKSSQGKNTSTTSTGNKNFLAGRFSHL       211 - 277
//

Text Mined References (68)

PMID Year Title
27143355 2016 Tumor Necrosis Factor-stimulated Gene 6 (TSG-6)-mediated Interactions with the Inter-?-inhibitor Heavy Chain 5 Facilitate Tumor Growth Factor ?1 (TGF?1)-dependent Fibroblast to Myofibroblast Differentiation.
27044744 2016 The Anti-inflammatory Protein TSG-6 Regulates Chemokine Function by Inhibiting Chemokine/Glycosaminoglycan Interactions.
26685054 2016 Nuclear Magnetic Resonance Insight into the Multiple Glycosaminoglycan Binding Modes of the Link Module from Human TSG-6.
26468290 2015 Metal Ion-dependent Heavy Chain Transfer Activity of TSG-6 Mediates Assembly of the Cumulus-Oocyte Matrix.
25661977 2015 Anti-inflammatory cytokine TSG-6 inhibits hypertrophic scar formation in a rabbit ear model.
25561734 2015 Heavy chain transfer by tumor necrosis factor-stimulated gene 6 to the bikunin proteoglycan.
25329668 2015 Human adipose-derived stem cells ameliorate cigarette smoke-induced murine myelosuppression via secretion of TSG-6.
25325979 2015 Analysis of the heavy-chain modification and TSG-6 activity in pathological hyaluronan matrices.
24501198 2014 TSG-6 inhibits neutrophil migration via direct interaction with the chemokine CXCL8.
24403066 2014 A refined model for the TSG-6 link module in complex with hyaluronan: use of defined oligosaccharides to probe structure and function.
More...