Property Summary

NCBI Gene PubMed Count 71
PubMed Score 189.29
PubTator Score 124.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Arthritis 290 4.077 2.0
Ulceroglandular tularemia 2 3.759 1.9

Expression

  Differential Expression (33)

 GO Function (1)

Gene RIF (59)

AA Sequence

MIILIYLFLLLWEDTQGWGFKDGIFHNSIWLERAAGVYHREARSGKYKLTYAEAKAVCEFEGGHLATYKQ      1 - 70
LEAARKIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGIRLNRSERWDAYCYNPHAKECGGVFT     71 - 140
DPKQIFKSPGFPNEYEDNQICYWHIRLKYGQRIHLSFLDFDLEDDPGCLADYVEIYDSYDDVHGFVGRYC    141 - 210
GDELPDDIISTGNVMTLKFLSDASVTAGGFQIKYVAMDPVSKSSQGKNTSTTSTGNKNFLAGRFSHL       211 - 277
//

Text Mined References (72)

PMID Year Title