Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.00
PubTator Score 5.00

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
26103464 Np9 contributes to the regulation of the p53-MDM2 pathway specifically in humans, chimpanzees and gorillas.

AA Sequence

MGQTKSKIKSKYASYLSFIKILLKRGGVKVSTKNLIKLFQIIEQFCPWFPEQGTSDLKDWKRIGKELKQA      1 - 70
GRKGNIIPLTVWNDWAIIKAALEPFQTEEDSISVSDAPGSCLIDCNENTRKKSQKETESLHCEYVAEPVM     71 - 140
AQSTQNVDYNQLQEVIYPETLKLEGKGPELMGPSESKPRGTSPLPAGQVLVRLQPQKQVKENKTQPQVAY    141 - 210
QYWPLAELQYRPPPESQYGYPGMPPAPQGRAPYHQPPTRRLNPMAPPSRQGSELHEIIDKSRKEGDTEAW    211 - 280
QFPVTLEPMPPGEGAQEGEPPTVEARYKSFSIKMLKDMKEGVKQYGPNSPYMRTLLDSIAYGHRLIPYDW    281 - 350
EILAKSSLSPSQFLQFKTWWIDGVQEQVRRNRAANPPVNIDADQLLGIGQNWSTISQQALMQNEAIEQVR    351 - 420
AICLRAWEKIQDPGSTCPSFNTVRQGSKEPYPDFVARLQDVAQKSIADEKAGKVIVELMAYENANPECQS    421 - 490
AIKPLKGKVPAGSDVISEYVKACDGIGGAMHKAMLMAQAITGVVLGGQVRTFGGKCYNCGQIGHLKKNCP    491 - 560
VLNKQNITIQATTTGREPPDLCPRCKKGKHWASQCRSKFDKNGQPLSGNEQRGQPQAPQQTGAFPIQPFV    561 - 630
PQGFQGQQPPLSQVFQGISQLPQYNNCPSPQAAVQQ                                      631 - 666
//

Text Mined References (14)

PMID Year Title
26103464 2015 Np9, a cellular protein of retroviral ancestry restricted to human, chimpanzee and gorilla, binds and regulates ubiquitin ligase MDM2.
21542922 2011 A revised nomenclature for transcribed human endogenous retroviral loci.
18664271 2008 Expression patterns of transcribed human endogenous retrovirus HERV-K(HML-2) loci in human tissues and the need for a HERV Transcriptome Project.
15476554 2004 Identification of endogenous retroviral reading frames in the human genome.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
11278433 2001 Inhibition of human endogenous retrovirus-K10 protease in cell-free and cell-based assays.
10469592 1999 Many human endogenous retrovirus K (HERV-K) proviruses are unique to humans.
9860826 1998 Functional characterization of the protease of human endogenous retrovirus, K10: can it complement HIV-1 protease?
9217052 1997 Characterization of human endogenous retrovirus type K virus-like particles generated from recombinant baculoviruses.
More...