Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.54
PubTator Score 6.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Hermansky-Pudlak syndrome 42 3.902 2.0

Expression

Synonym

Accession P86791 A2RU45 O95766 Q9UG65 Q9Y359
Symbols CCZ1A
CGI-43
C7orf28A
H_DJ1163J12.2

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG

Gene RIF (1)

AA Sequence

MAAAAAGAGSGPWAAQEKQFPPALLSFFIYNPRFGPREGQEENKILFYHPNEVEKNEKIRNVGLCEAIVQ      1 - 70
FTRTFSPSKPAKSLHTQKNRQFFNEPEENFWMVMVVRNPIIEKQSKDGKPVIEYQEEELLDKVYSSVLRQ     71 - 140
CYSMYKLFNGTFLKAMEDGGVKLLKERLEKFFHRYLQTLHLQSCDLLDIFGGISFFPLDKMTYLKIQSFI    141 - 210
NRMEESLNIVKYTAFLYNDQLIWSGLEQDDMRILYKYLTTSLFPRHIEPELAGRDSPIRAEMPGNLQHYG    211 - 280
RFLTGPLNLNDPDAKCRFPKIFVNTDDTYEELHLIVYKAMSAAVCFMIDASVHPTLDFCRRLDSIVGPQL    281 - 350
TVLASDICEQFNINKRMSGSEKEPQFKFIYFNHMNLAEKSTVHMRKTPSVSLTSVHPDLMKILGDINSDF    351 - 420
TRVDEDEEIIVKAMSDYWVVGKKSDRRELYVILNQKNANLIEVNEEVKKLCATQFNNIFFLD            421 - 482
//

Text Mined References (19)

PMID Year Title