Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Facioscapulohumeral muscular dystrophy 26 4.497 2.2

Synonym

Accession P86479 Q8N7V5
Symbols

Gene

 Compartment GO Term (1)

 HCA RNA Cell Line (2)

AA Sequence

MEEPRPSKRLRSMAPNQASGGPPPEPGCCVADPEGSVEADGPAQPAQPAKPIAYVKPFRRQPPARPESPP      1 - 70
PAERGRRRGGSRRPGRGRGRRAGPRGDAGQRQGAEGLMAPDVHIQLDHHGEPGHQGEPEITETAAFSLSE     71 - 140
TGPPPGTVQEGPGPDVAQPELGFQEPPAAPGPQAVDWQPVLTLYPCIGFRALGDSAVLQVIQTPQGTYVQ    141 - 210
GVPVFLTDIAY                                                               211 - 221
//

Text Mined References (3)

PMID Year Title