Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Synonym

Accession P86479 Q8N7V5
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MEEPRPSKRLRSMAPNQASGGPPPEPGCCVADPEGSVEADGPAQPAQPAKPIAYVKPFRRQPPARPESPP      1 - 70
PAERGRRRGGSRRPGRGRGRRAGPRGDAGQRQGAEGLMAPDVHIQLDHHGEPGHQGEPEITETAAFSLSE     71 - 140
TGPPPGTVQEGPGPDVAQPELGFQEPPAAPGPQAVDWQPVLTLYPCIGFRALGDSAVLQVIQTPQGTYVQ    141 - 210
GVPVFLTDIAY                                                               211 - 221
//

Text Mined References (1)

PMID Year Title
15057823 2004 The DNA sequence and analysis of human chromosome 13.