Property Summary

NCBI Gene PubMed Count 8
Grant Count 14
R01 Count 5
Funding $8,601,228.67
PubMed Score 9.28
PubTator Score 3.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Malignant neoplasm of breast 63

Gene RIF (3)

PMID Text
26056301 results of this study show that the effect of ZBED6 on tumor development depends on the genetic background and the transcriptional state of its target genes
20134481 Mouse MGR (Zbed6) is a repressor of Igf2.
20016685 Silencing of Zbed6 in mouse C2C12 myoblasts affected Igf2 expression, cell proliferation, wound healing, and myotube formation.

AA Sequence

MSVCTLSVPVSSLSPGRRCNTFSDSGILGCVPINSNTDEEDVVEEKMVAEGVNKEAKQPAKKKRKKGLRI      1 - 70
KGKRRRKKLILAKKFSKDLGSGRPVADAPALLASNDPEQDEESLFESNIEKQIYLPSTRAKTSIVWHFFH     71 - 140
VDPQYTWRAICNLCEKSVSRGKPGSHLGTSTLQRHLQARHSPHWTRANKFGVASGEEDFTLDVSLSPSSG    141 - 210
SNGSFEYIPTDPLDDNRMGKKHDKSASDALRAERGRFLIKSNIVKHALIPGTRAKTSAVWNFFYTDPQHI    211 - 280
SRAVCNICKRSVSRGRPGSHLGTSTLQRHLQATHPIHWAVANKDSGAVANGLDEAETERSDLLSDTLHGE    281 - 350
KSTGSQDLTAEDLSDSDSDEPMLEVENRSESPIPVAEQGTLMRAQERETTCCGNPVSSHISQAIIQMIVE    351 - 420
DMHPYNYFSTPAFQRFMQIVAPDYRLPSETYFFTKAVPQLYDCVREKIFLTLENVQSQKIHLTVDIWTHD    421 - 490
PSTDYFIVTVHWVSLETASFLNNGRIPDFRKWAVLCVTGLAKDCLITNILQELNDQIGLWLSPNFLIPSF    491 - 560
IVSDNSSNVVHAIKDGGFTHVPCFLHCLNMVIQDFFCEHKSIENMLVAARKTCHHFSHSVKARQILQEFQ    561 - 630
NDHQLPWKNLKQDETGHWISTFYMLKWLLEHCYSVHHSLGRASGVVLTSLQWTLMTYVCDILKPFEEATQ    631 - 700
KVSVKTAGLNQVLPLIHHLLLSLQKLREDFQVRGITQALNLVDSLSLKLETDTLLSAMLKSKPCILATLL    701 - 770
DPCFKNSLEDFFPQGADLETYKQFLAEEVCNYMESSPEICQIPTSEASCPSVTVGADSFTSSLKEGTSSS    771 - 840
GSVDSSAVDNVALGSKSFMFPSAVAVVDEYFKEKYSEFSGGDDPLIYWQRKISIWPALTQVAIQYLSCPM    841 - 910
CSWQSECIFTKNSHFHPKQIMSLDFDNIEQLMFLKMNLKNVNYDYSTLVLSWDPEQNEVVQSSEKEILP     911 - 979
//

Text Mined References (8)

PMID Year Title
26056301 2015 Transcriptional modulator ZBED6 affects cell cycle and growth of human colorectal cancer cells.
25038754 2014 Genome-wide association analysis in East Asians identifies breast cancer susceptibility loci at 1q32.1, 5q14.3 and 15q26.1.
24043816 2013 Transcription factor ZBED6 affects gene expression, proliferation, and cell death in pancreatic beta cells.
23533661 2013 ZBED evolution: repeated utilization of DNA transposons as regulators of diverse host functions.
20375320 2009 Studying phenotypic evolution in domestic animals: a walk in the footsteps of Charles Darwin.
20134481 2010 A domesticated transposon mediates the effects of a single-nucleotide polymorphism responsible for enhanced muscle growth.
20016685 2009 ZBED6, a novel transcription factor derived from a domesticated DNA transposon regulates IGF2 expression and muscle growth.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.