Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 3.9e-24
diabetes mellitus 1728 1.4e-03

Synonym

Accession P86434
Symbols C22orf45

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MEQDWQPGEEVTPGPEPCSKGQAPLYPIVHVTELKHTDPNFPSNSNAVGTSSGWNRIGTGCSHTWDWRFS      1 - 70
CTQQALLPLLGAWEWSIDTEAGGGRREQSQKPCSNGGPAAAGEGRVLPSPCFPWSTCQAAIHKVCRWQGC     71 - 140
TRPALLAPSLATLKEHSYP                                                       141 - 159
//

Text Mined References (6)

PMID Year Title