Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Acne vulgaris 16
Disease Target Count P-value
psoriasis 6685 3.87305518333038E-24
diabetes mellitus 1663 0.00139994407082523

Synonym

Accession P86434
Symbols C22orf45

 Compartment GO Term (0)

 GWAS Trait (1)

Pathway (1)

Gene RIF (1)

PMID Text
19726446 C22orf45 is a novel human-specific protein-coding gene.

AA Sequence

MEQDWQPGEEVTPGPEPCSKGQAPLYPIVHVTELKHTDPNFPSNSNAVGTSSGWNRIGTGCSHTWDWRFS      1 - 70
CTQQALLPLLGAWEWSIDTEAGGGRREQSQKPCSNGGPAAAGEGRVLPSPCFPWSTCQAAIHKVCRWQGC     71 - 140
TRPALLAPSLATLKEHSYP                                                       141 - 159
//

Text Mined References (6)

PMID Year Title
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
19726446 2009 Recent de novo origin of human protein-coding genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.