Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.00
PubTator Score 380.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Rheumatoid Arthritis 1171
Disease Target Count P-value
osteosarcoma 7933 1.54636906154163E-6

Synonym

Accession P86397 HsHTD2
Symbols P14
HsHTD2

Gene

PDB

3IR3  

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Rat OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA EggNOG

 GWAS Trait (1)

Gene RIF (1)

PMID Text
11929972 A protein subunit of human RNase P, Rpp14, and its interacting partner, OIP2, have 3'-->5' exoribonuclease activity.

AA Sequence

MFPLISSHHLWWGGLRRTVCLNLPVLTLQHFQHMHIKVGDRAELRRAFTQTDVATFSELTGDVNPLHLNE      1 - 70
DFAKHTKFGNTIVHGVLINGLISALLGTKMPGPGCVFLSQEISFPAPLYIGEVVLASAEVKKLKRFIAII     71 - 140
AVSCSVIESKKTVMEGWVKVMVPEASKS                                              141 - 168
//

Text Mined References (16)

PMID Year Title
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
17898086 2008 An ancient genetic link between vertebrate mitochondrial fatty acid synthesis and RNA processing.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15096576 2004 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...