Property Summary

NCBI Gene PubMed Count 13
Grant Count 11
R01 Count 7
Funding $1,071,001.5
PubMed Score 2.97
PubTator Score 1.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 2.800 0.000
psoriasis 1.100 0.003
osteosarcoma -2.036 0.000
colon cancer 1.300 0.003
group 3 medulloblastoma -1.300 0.011
gastric carcinoma 1.100 0.035
ductal carcinoma in situ -1.200 0.003
invasive ductal carcinoma -1.300 0.023
ovarian cancer 1.900 0.000
pituitary cancer -1.700 0.000

Gene RIF (4)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17599906 The inhibition of Akt and S6K1 phosphorylation by PRR5 knock down correlates with reduction in the expression level of platelet-derived growth factor receptor beta (PDGFRbeta).
17461779 It was demonstrated that immunoprecipitation of Protor-1 or Protor-2 results in the co-immunoprecipitation of other mTORC2 subunits, but not Raptor, a specific component of mTORC1.
15718101 mRNA expression analyses revealed PRR5 overexpression in a majority of colorectal tumors but substantial downregulation of PRR5 expression in a subset of breast tumors and reduced expression in two breast cancer cell lines

AA Sequence

MRTLRRLKFMSSPSLSDLGKREPAAAADERGTQQRRACANATWNSIHNGVIAVFQRKGLPDQELFSLNEG      1 - 70
VRQLLKTELGSFFTEYLQNQLLTKGMVILRDKIRFYEGQKLLDSLAETWDFFFSDVLPMLQAIFYPVQGK     71 - 140
EPSVRQLALLHFRNAITLSVKLEDALARAHARVPPAIVQMLLVLQGVHESRGVTEDYLRLETLVQKVVSP    141 - 210
YLGTYGLHSSEGPFTHSCILEKRLLRRSRSGDVLAKNPVVRSKSYNTPLLNPVQEHEAEGAAAGGTSIRR    211 - 280
HSVSEMTSCPEPQGFSDPPGQGPTGTFRSSPAPHSGPCPSRLYPTTQPPEQGLDPTRSSLPRSSPENLVD    281 - 350
QILESVDSDSEGIFIDFGRGRGSGMSDLEGSGGRQSVV                                    351 - 388
//

Text Mined References (16)

PMID Year Title
24882193 2014 Bipolar disorder with comorbid binge eating history: a genome-wide association study implicates APOB.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22609986 2012 PRR5L degradation promotes mTORC2-mediated PKC-? phosphorylation and cell migration downstream of G?12.
22554406 2012 Family-based genome-wide association study of frontal ? oscillations identifies potassium channel gene KCNJ6.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17599906 2007 PRR5, a novel component of mTOR complex 2, regulates platelet-derived growth factor receptor beta expression and signaling.
17461779 2007 Identification of Protor as a novel Rictor-binding component of mTOR complex-2.
15718101 2005 PRR5 encodes a conserved proline-rich protein predominant in kidney: analysis of genomic organization, expression, and mutation status in breast and colorectal carcinomas.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
More...