Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.70
PubTator Score 1.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Orofacial cleft 54 0.0 1.4
substance-related disorder 162 0.0 1.2
Disease Target Count Z-score Confidence
Cataract 7 32 3.962 2.0

Expression

  Differential Expression (10)

Disease log2 FC p
colon cancer 1.300 3.1e-03
ductal carcinoma in situ -1.200 2.5e-03
gastric carcinoma 1.100 3.5e-02
group 3 medulloblastoma -1.300 1.1e-02
invasive ductal carcinoma -1.300 2.3e-02
malignant mesothelioma 1.400 1.2e-04
osteosarcoma -1.588 1.0e-03
ovarian cancer 1.900 3.1e-06
pituitary cancer -1.300 1.7e-04
psoriasis 1.100 2.5e-03

Gene RIF (4)

AA Sequence

MRTLRRLKFMSSPSLSDLGKREPAAAADERGTQQRRACANATWNSIHNGVIAVFQRKGLPDQELFSLNEG      1 - 70
VRQLLKTELGSFFTEYLQNQLLTKGMVILRDKIRFYEGQKLLDSLAETWDFFFSDVLPMLQAIFYPVQGK     71 - 140
EPSVRQLALLHFRNAITLSVKLEDALARAHARVPPAIVQMLLVLQGVHESRGVTEDYLRLETLVQKVVSP    141 - 210
YLGTYGLHSSEGPFTHSCILEKRLLRRSRSGDVLAKNPVVRSKSYNTPLLNPVQEHEAEGAAAGGTSIRR    211 - 280
HSVSEMTSCPEPQGFSDPPGQGPTGTFRSSPAPHSGPCPSRLYPTTQPPEQGLDPTRSSLPRSSPENLVD    281 - 350
QILESVDSDSEGIFIDFGRGRGSGMSDLEGSGGRQSVV                                    351 - 388
//

Text Mined References (16)

PMID Year Title