Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.86
PubTator Score 6.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Restless legs syndrome 28 6.239 3.1

Expression

Synonym

Accession P84550 A6NIP4 A6NJY0 Q2VWA5
Symbols CORL1
LBXCOR1
FUSSEL15

Gene

PANTHER Protein Class (1)

Gene RIF (6)

PMID Text
21641385 Permanent expression of Fussel-15 in keloid and skin sclerosis fibroblasts could be involved in the pathogenesis of these conditions.
19822783 Observational study of gene-disease association. (HuGE Navigator)
19279021 Observational study of gene-disease association. (HuGE Navigator)
18541116 MEIS1 and LBXCOR1 are developmental factors and raise new pathophysiologic questions for RLS.
17637780 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17292623 a novel gene, fussel-15 (functional smad suppressing element on chromosome 15) with high homology to the recently discovered Fussel-18 protein.

AA Sequence

MALLCGLGQVTLRIWVSLPSQSENGIGFLAARAFLRSGGMEALTTQLGPGREGSSSPNSKQELQPYSGSS      1 - 70
ALKPNQVGETSLYGVPIVSLVIDGQERLCLAQISNTLLKNYSYNEIHNRRVALGITCVQCTPVQLEILRR     71 - 140
AGAMPISSRRCGMITKREAERLCKSFLGEHKPPKLPENFAFDVVHECAWGSRGSFIPARYNSSRAKCIKC    141 - 210
GYCSMYFSPNKFIFHSHRTPDAKYTQPDAANFNSWRRHLKLSDKSATDELSHAWEDVKAMFNGGTRKRTF    211 - 280
SLQGGGGGGANGGSGGQGKGGAGGGGGGGPGCGAEMAPGPPPHKSLRCGEDEAAGPPGPPPPHPQRGLGL    281 - 350
ATGASGPAGPGGPGGGAGVRSYPVIPVPSKGFGLLQKLPPPLFPHPYGFPTAFGLCPKKDDPVLGAGEPK    351 - 420
GGPGTGSGGGGAGTGGGAGGPGASHLPPGAGAGPGGGAMFWGHQPSGAAKDAAAVAAAAAAATVYPTFPM    421 - 490
FWPAAGSLPVPSYPAAQSQAKAVAAAVAAAAAAAAAAAGSGAPEPLDGAEPAKESGLGAEERCPSALSRG    491 - 560
PLDEDGTDEALPPPLAPLPPPPPPPARKGSYVSAFRPVVKDTESIAKLYGSAREAYGAGPARGPGPGAGS    561 - 630
GGYVSPDFLSEGSSSYNSASPDVDTADEPEVDVESNRFPDDEDAQEETEPSAPSAGGGPDGEQPTGPPSA    631 - 700
TSSGADGPANSPDGGSPRPRRRLGPPPAGRPAFGDLAAEDLVRRPERSPPSGGGGYELREPCGPLGGPAP    701 - 770
AKVFAPERDEHVKSAAVALGPAASYVCTPEAHEPDKEDNHSPADDLETRKSYPDQRSISQPSPANTDRGE    771 - 840
DGLTLDVTGTHLVEKDIENLAREELQKLLLEQMELRKKLEREFQSLKDNFQDQMKRELAYREEMVQQLQI    841 - 910
VRDTLCNELDQERKARYAIQQKLKEAHDALHHFSCKMLTPRHCTGNCSFKPPLLP                   911 - 965
//

Text Mined References (11)

PMID Year Title
21779176 2011 Genome-wide association study identifies novel restless legs syndrome susceptibility loci on 2p14 and 16q12.1.
21641385 2011 Fussel-15, a new player in wound healing, is deregulated in keloid and localized scleroderma.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
19822783 2009 Association of intronic variants of the BTBD9 gene with Tourette syndrome.
19279021 2009 Replication of restless legs syndrome loci in three European populations.
18541116 2008 Genetics of restless legs syndrome.
17637780 2007 Genome-wide association study of restless legs syndrome identifies common variants in three genomic regions.
17292623 2007 Fussel-15, a novel Ski/Sno homolog protein, antagonizes BMP signaling.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15528197 2005 Corl1, a novel neuronal lineage-specific transcriptional corepressor for the homeodomain transcription factor Lbx1.
More...