Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.23
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
active Crohn's disease 2.119 7.0e-03
astrocytic glioma -1.200 2.3e-02
Atopic dermatitis -1.100 3.4e-04
atypical teratoid / rhabdoid tumor -1.100 2.1e-04
breast carcinoma -1.100 4.4e-05
Duchenne muscular dystrophy 1.164 2.2e-09
ductal carcinoma in situ -1.300 1.3e-03
ependymoma -1.200 1.0e-02
fibroadenoma -1.200 3.7e-03
intraductal papillary-mucinous adenoma (... -2.300 5.7e-04
intraductal papillary-mucinous carcinoma... -1.600 1.1e-02
intraductal papillary-mucinous neoplasm ... -2.400 5.8e-03
invasive ductal carcinoma -1.600 9.6e-03
non primary Sjogren syndrome sicca 1.100 3.7e-02
oligodendroglioma -1.100 7.5e-03
osteosarcoma 1.232 1.0e-02
ovarian cancer -1.800 8.0e-05
pancreatic cancer 1.100 1.3e-02
primary pancreatic ductal adenocarcinoma 1.296 1.7e-02
psoriasis -1.100 1.5e-05
tuberculosis -1.300 3.7e-04
ulcerative colitis 1.400 4.1e-03

AA Sequence

MEAPAELLAALPALATALALLLAWLLVRRGAAASPEPARAPPEPAPPAEATGAPAPSRPCAPEPAASPAG      1 - 70
PEEPGEPAGLGELGEPAGPGEPEGPGDPAAAPAEAEEQAVEARQEEEQDLDGEKGPSSEGPEEEDGEGFS     71 - 140
FKYSPGKLRGNQYKKMMTKEELEEEQRVQKEQLAAIFKLMKDNKETFGEMSDGDVQEQLRLYDM          141 - 204
//

Text Mined References (10)

PMID Year Title