Property Summary

NCBI Gene PubMed Count 75
Grant Count 25
R01 Count 12
Funding $3,219,821.92
PubMed Score 68.68
PubTator Score 67.44

Knowledge Summary

Patent

No data available

Expression

Gene RIF (41)

PMID Text
26876937 Results show that YTHDC1 promotes exon inclusion in targeted mRNAs through recruiting pre-mRNA splicing factor SRSF3 while blocking SRSF10 mRNA binding.
26773498 We propose that SRSF3 could act as a coordinator of the expression of PDCD4 protein via two mechanisms on two alternatively spliced mRNA isoforms.
26704980 These data indicate that SRSF3 affects a global change of gene expression to maintain cell homeostasis.
26416554 PTBP1 and PTBP2 impaired autoregulation of SRSF3 in oral squamous cell carcinoma cancer cells.
26367347 SRSF3 and hnRNP H1 are the first splicing factors identified which regulate the production of these functionally distinct HER2 splice variants and therefore maybe important for the regulation of HER2 signaling.
26282282 This new function of SRSF3 not only explains why overexpression of SRSF3 is required for ovarian cancer cell growth and survival but also offers a new insight into the mechanism of the neoplastic transformation.
26119931 we also demonstrated frequent co-overexpression and positive correlation of DARPP-32, SRp20 and CD44E expression levels in human gastric primary tumors.
25506695 Depletion of two of the most potent inhibitors of SMP2 exon 7 inclusion, SRSF2 or SRSF3, in cell lines derived from SMA patients, increased SMN2 exon 7 inclusion and SMN protein level.
25416801 SRSF3 (serine/arginine-rich splicing factor 3) inhibits HIV-1 Tat-mediated transactivation activity in HEK293 cells
25234929 Results identified modulation of SRSF3 activity as the molecular mechanism by which ORF57 promotes RNA splicing.
More...

AA Sequence

MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRT      1 - 70
LCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRSFSRSRSRSLSRDRRRERSLS     71 - 140
RERNHKPSRSFSRSRSRSRSNERK                                                  141 - 164
//

Text Mined References (85)

PMID Year Title
26876937 2016 Nuclear m(6)A Reader YTHDC1 Regulates mRNA Splicing.
26773498 2016 SRSF3 represses the expression of PDCD4 protein by coordinated regulation of alternative splicing, export and translation.
26704980 2016 A genome landscape of SRSF3-regulated splicing events and gene expression in human osteosarcoma U2OS cells.
26416554 2015 PTBP1 and PTBP2 impaired autoregulation of SRSF3 in cancer cells.
26367347 2015 SRSF3 and hnRNP H1 regulate a splicing hotspot of HER2 in breast cancer cells.
26282282 2015 Serine/arginine-rich splicing factor 3 (SRSF3) regulates homologous recombination-mediated DNA repair.
26119931 2016 Regulation of CD44E by DARPP-32-dependent activation of SRp20 splicing factor in gastric tumorigenesis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25506695 2014 Targeting SR proteins improves SMN expression in spinal muscular atrophy cells.
25234929 2014 Attenuation of the suppressive activity of cellular splicing factor SRSF3 by Kaposi sarcoma-associated herpesvirus ORF57 protein is required for RNA splicing.
More...