Property Summary

NCBI Gene PubMed Count 75
PubMed Score 68.68
PubTator Score 67.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 1.4844209167918E-17
ovarian cancer 8492 2.7334880360037E-7
acute quadriplegic myopathy 1157 1.35942786539291E-6
posterior fossa group B ependymoma 1530 1.23417403667613E-5
pituitary cancer 1972 7.17267321920337E-5
medulloblastoma, large-cell 6234 1.27612549838347E-4
psoriasis 6685 2.42007201694706E-4
group 3 medulloblastoma 2254 4.59928010613658E-4
Multiple myeloma 1328 7.77525938801553E-4
primitive neuroectodermal tumor 3031 0.00186604149089603
invasive ductal carcinoma 2950 0.00297643884464918
primary Sjogren syndrome 789 0.00570762696375291
Parkinson's disease 364 0.0138077588931283
subependymal giant cell astrocytoma 2287 0.0252851884997621
Polycystic Ovary Syndrome 335 0.0406087027338777
Hydrolethalus syndrome 128 0.0479569922799098

Expression

Synonym

Accession P84103 B4E241 O08831 P23152 Q5R3K0
Symbols SFRS3
SRp20

Gene

PDB

2I2Y   2I38  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
Zebrafish OMA EggNOG

Gene RIF (41)

PMID Text
26876937 Results show that YTHDC1 promotes exon inclusion in targeted mRNAs through recruiting pre-mRNA splicing factor SRSF3 while blocking SRSF10 mRNA binding.
26773498 We propose that SRSF3 could act as a coordinator of the expression of PDCD4 protein via two mechanisms on two alternatively spliced mRNA isoforms.
26704980 These data indicate that SRSF3 affects a global change of gene expression to maintain cell homeostasis.
26416554 PTBP1 and PTBP2 impaired autoregulation of SRSF3 in oral squamous cell carcinoma cancer cells.
26367347 SRSF3 and hnRNP H1 are the first splicing factors identified which regulate the production of these functionally distinct HER2 splice variants and therefore maybe important for the regulation of HER2 signaling.
26282282 This new function of SRSF3 not only explains why overexpression of SRSF3 is required for ovarian cancer cell growth and survival but also offers a new insight into the mechanism of the neoplastic transformation.
26119931 we also demonstrated frequent co-overexpression and positive correlation of DARPP-32, SRp20 and CD44E expression levels in human gastric primary tumors.
25506695 Depletion of two of the most potent inhibitors of SMP2 exon 7 inclusion, SRSF2 or SRSF3, in cell lines derived from SMA patients, increased SMN2 exon 7 inclusion and SMN protein level.
25416801 SRSF3 (serine/arginine-rich splicing factor 3) inhibits HIV-1 Tat-mediated transactivation activity in HEK293 cells
25234929 Results identified modulation of SRSF3 activity as the molecular mechanism by which ORF57 promotes RNA splicing.
More...

AA Sequence

MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRT      1 - 70
LCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRSFSRSRSRSLSRDRRRERSLS     71 - 140
RERNHKPSRSFSRSRSRSRSNERK                                                  141 - 164
//

Text Mined References (85)

PMID Year Title
26876937 2016 Nuclear m(6)A Reader YTHDC1 Regulates mRNA Splicing.
26773498 2016 SRSF3 represses the expression of PDCD4 protein by coordinated regulation of alternative splicing, export and translation.
26704980 2016 A genome landscape of SRSF3-regulated splicing events and gene expression in human osteosarcoma U2OS cells.
26416554 2015 PTBP1 and PTBP2 impaired autoregulation of SRSF3 in cancer cells.
26367347 2015 SRSF3 and hnRNP H1 regulate a splicing hotspot of HER2 in breast cancer cells.
26282282 2015 Serine/arginine-rich splicing factor 3 (SRSF3) regulates homologous recombination-mediated DNA repair.
26119931 2016 Regulation of CD44E by DARPP-32-dependent activation of SRp20 splicing factor in gastric tumorigenesis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25506695 2014 Targeting SR proteins improves SMN expression in spinal muscular atrophy cells.
25234929 2014 Attenuation of the suppressive activity of cellular splicing factor SRSF3 by Kaposi sarcoma-associated herpesvirus ORF57 protein is required for RNA splicing.
More...