Property Summary

NCBI Gene PubMed Count 83
PubMed Score 74.67
PubTator Score 67.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute quadriplegic myopathy 1.016 1.4e-06
group 3 medulloblastoma 2.000 4.6e-04
Hydrolethalus syndrome -1.053 4.8e-02
invasive ductal carcinoma -1.400 3.0e-03
medulloblastoma, large-cell 1.400 1.3e-04
Multiple myeloma 1.648 7.8e-04
non primary Sjogren syndrome sicca 1.100 2.7e-02
non-small cell lung cancer -1.131 1.5e-17
ovarian cancer -1.200 6.7e-05
Parkinson's disease -1.100 1.4e-02
pituitary cancer 1.100 7.2e-05
Polycystic ovary syndrome 1.049 4.1e-02
posterior fossa group B ependymoma 1.100 1.2e-05
primitive neuroectodermal tumor 1.100 1.9e-03
psoriasis -1.400 2.4e-04
subependymal giant cell astrocytoma -1.203 2.5e-02

Gene RIF (47)

AA Sequence

MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRT      1 - 70
LCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRSFSRSRSRSLSRDRRRERSLS     71 - 140
RERNHKPSRSFSRSRSRSRSNERK                                                  141 - 164
//

Text Mined References (93)

PMID Year Title