Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.60
PubTator Score 0.58

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P84101 A6NL45 B5MCG1 B9A026 O75918 O88891 Q9BZH7
Symbols FAM2C
4F5REL
H4F5REL
HsT17089

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MTRGNQRELARQKNMKKQSDSVKGKRRDDGLSAAARKQRDSEIMQQKQKKANEKKEEPK                 1 - 59
//

Text Mined References (15)

PMID Year Title