Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.20
PubTator Score 0.58

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
20723760 The human orthologs of MOAG-4, SERF2 and SERF1A, are ubiquitously expressed, consistent with a role in a general cellular pathway.

AA Sequence

MTRGNQRELARQKNMKKQSDSVKGKRRDDGLSAAARKQRDSEIMQQKQKKANEKKEEPK                 1 - 59
//

Text Mined References (15)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
20723760 2010 Identification of MOAG-4/SERF as a regulator of age-related proteotoxicity.
17568003 2007 Structured RNAs in the ENCODE selected regions of the human genome.
16927404 Blocking BE301622 gene expression by RNAi initiates differentiation of neural stem cells in rat.
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...