Property Summary

NCBI Gene PubMed Count 29
PubMed Score 37.33
PubTator Score 21.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.3e-03
mucosa-associated lymphoid tissue lymphoma 484 1.3e-02
Disease Target Count Z-score Confidence
Fatal familial insomnia 10 3.085 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 2.000 1.3e-03
mucosa-associated lymphoid tissue lympho... -1.091 1.3e-02

Gene RIF (7)

AA Sequence

MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSRARCRKNTLAR      1 - 70
RKGRHMGIGKRKGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNVFKNKRILME     71 - 140
HIHKLKADKARKKLLADQAEARRSKTKEARKRREERLQAKKEEIIKTLSKEEETKK                  141 - 196
//

Text Mined References (40)

PMID Year Title