Property Summary

NCBI Gene PubMed Count 44
PubMed Score 108.11
PubTator Score 74.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.4e-07
psoriasis 6694 1.3e-04
osteosarcoma 7950 2.8e-02
astrocytoma 1146 3.2e-02
Disease Target Count Z-score Confidence
Oral hairy leukoplakia 6 3.237 1.6
Paratyphoid fever 10 3.134 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytoma 1.100 3.2e-02
osteosarcoma -1.125 2.8e-02
ovarian cancer 2.000 1.4e-07
psoriasis 2.200 1.3e-04

Gene RIF (23)

AA Sequence

MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAGQEEYDRLRTL      1 - 70
SYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQ     71 - 140
QGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPTPIKRGRSCILL                       141 - 191
//

Text Mined References (49)

PMID Year Title