Property Summary

NCBI Gene PubMed Count 40
Grant Count 36
R01 Count 19
Funding $1,707,752.44
PubMed Score 103.98
PubTator Score 74.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 2.200 0.000
osteosarcoma -1.125 0.028
astrocytoma 1.100 0.032
ovarian cancer 2.000 0.000

Gene RIF (19)

PMID Text
26746014 This study describes the regulation of EMT in RPE cells by TGF-beta1/miR-124/RHOG signaling and suggests that the supplement of miR-124 exogenously would be a valuable therapeutic approach for the prevention or treatment of proliferative vitreoretinopathy.
24106269 RhoG is expressed and activated in platelets, plays an important role in GPVI-Fc receptor gamma-chain complex-mediated platelet activation, and is critical for thrombus formation in vivo.
22683270 several Rho family small GTPases activate PI3K by an indirect cooperative positive feedback that required a combination of Rac, CDC42, and RhoG small GTPase activities
22383878 The invasive capacity of HPV transformed cells requires the hDlg-dependent enhancement of SGEF/RhoG activity.
22251971 The authors show that enteropathogenic Escherichia coli translocates EspH, which inactivates mammalian RhoGEFs and triggers cytotoxicity.
20679435 The activation of RhoG recruits its effector ELMO2 and a Rac GEF Dock4 to form a complex with EphA2 at the tips of cortactin-rich protrusions in migrating breast cancer cells.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19730683 Observational study of gene-disease association. (HuGE Navigator)
19208761 Results suggest that RhoG is a central target of the Yersinia stratagem and a major upstream regulator of Rac1 during different phases of the Yersinia infection cycle.
17875742 These results identify a new signaling pathway involving RhoG and its exchange factor SGEF downstream from ICAM1 that is critical for leukocyte trans-endothelial migration.
More...

AA Sequence

MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAGQEEYDRLRTL      1 - 70
SYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQ     71 - 140
QGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPTPIKRGRSCILL                       141 - 191
//

Text Mined References (45)

PMID Year Title
26746014 2016 MicroRNA-124 Controls Transforming Growth Factor ?1-Induced Epithelial-Mesenchymal Transition in the Retinal Pigment Epithelium by Targeting RHOG.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24106269 2013 RhoG protein regulates glycoprotein VI-Fc receptor ?-chain complex-mediated platelet activation and thrombus formation.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22683270 2012 Cooperative activation of PI3K by Ras and Rho family small GTPases.
22383878 2012 The invasive capacity of HPV transformed cells requires the hDlg-dependent enhancement of SGEF/RhoG activity.
22251971 2012 The interplay between the Escherichia coli Rho guanine nucleotide exchange factor effectors and the mammalian RhoGEF inhibitor EspH.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
More...