Property Summary

NCBI Gene PubMed Count 40
PubMed Score 103.98
PubTator Score 74.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 1.37613118690371E-7
psoriasis 6685 1.327379570382E-4
osteosarcoma 7933 0.0283954336008336
astrocytoma 1493 0.0320810622315421
Disease Target Count Z-score Confidence
Oral hairy leukoplakia 6 3.252 1.6
Paratyphoid fever 10 3.179 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 2.200 0.000
osteosarcoma -1.125 0.028
astrocytoma 1.100 0.032
ovarian cancer 2.000 0.000

Synonym

Accession P84095 P35238 Q8NI04
Symbols ARHG

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus EggNOG Inparanoid

Gene RIF (19)

PMID Text
26746014 This study describes the regulation of EMT in RPE cells by TGF-beta1/miR-124/RHOG signaling and suggests that the supplement of miR-124 exogenously would be a valuable therapeutic approach for the prevention or treatment of proliferative vitreoretinopathy.
24106269 RhoG is expressed and activated in platelets, plays an important role in GPVI-Fc receptor gamma-chain complex-mediated platelet activation, and is critical for thrombus formation in vivo.
22683270 several Rho family small GTPases activate PI3K by an indirect cooperative positive feedback that required a combination of Rac, CDC42, and RhoG small GTPase activities
22383878 The invasive capacity of HPV transformed cells requires the hDlg-dependent enhancement of SGEF/RhoG activity.
22251971 The authors show that enteropathogenic Escherichia coli translocates EspH, which inactivates mammalian RhoGEFs and triggers cytotoxicity.
20679435 The activation of RhoG recruits its effector ELMO2 and a Rac GEF Dock4 to form a complex with EphA2 at the tips of cortactin-rich protrusions in migrating breast cancer cells.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19730683 Observational study of gene-disease association. (HuGE Navigator)
19208761 Results suggest that RhoG is a central target of the Yersinia stratagem and a major upstream regulator of Rac1 during different phases of the Yersinia infection cycle.
17875742 These results identify a new signaling pathway involving RhoG and its exchange factor SGEF downstream from ICAM1 that is critical for leukocyte trans-endothelial migration.
More...

AA Sequence

MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAGQEEYDRLRTL      1 - 70
SYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQ     71 - 140
QGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPTPIKRGRSCILL                       141 - 191
//

Text Mined References (45)

PMID Year Title
26746014 2016 MicroRNA-124 Controls Transforming Growth Factor ?1-Induced Epithelial-Mesenchymal Transition in the Retinal Pigment Epithelium by Targeting RHOG.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24106269 2013 RhoG protein regulates glycoprotein VI-Fc receptor ?-chain complex-mediated platelet activation and thrombus formation.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22683270 2012 Cooperative activation of PI3K by Ras and Rho family small GTPases.
22383878 2012 The invasive capacity of HPV transformed cells requires the hDlg-dependent enhancement of SGEF/RhoG activity.
22251971 2012 The interplay between the Escherichia coli Rho guanine nucleotide exchange factor effectors and the mammalian RhoGEF inhibitor EspH.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
More...