Property Summary

Ligand Count 1
NCBI Gene PubMed Count 158
PubMed Score 374.36
PubTator Score 307.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
acute myeloid leukemia 1.200 2.1e-02
adult high grade glioma -1.600 4.7e-04
atypical teratoid / rhabdoid tumor -1.100 4.4e-04
breast carcinoma 2.300 2.3e-03
diabetes mellitus -1.500 2.9e-02
glioblastoma -1.200 4.2e-04
medulloblastoma, large-cell -1.300 9.0e-05
Multiple myeloma 1.554 3.3e-05
ovarian cancer 1.700 2.1e-04

 MGI Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (87)

AA Sequence

MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGG      1 - 70
QDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEIT     71 - 140
DKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK                                 141 - 181
//

Text Mined References (171)

PMID Year Title