Property Summary

NCBI Gene PubMed Count 147
Grant Count 119
R01 Count 86
Funding $12,146,188.5
PubMed Score 358.02
PubTator Score 307.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.554 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma -1.200 0.000
medulloblastoma, large-cell -1.300 0.000
breast carcinoma 2.300 0.002
diabetes mellitus -1.500 0.029
adult high grade glioma -1.600 0.000
acute myeloid leukemia 1.600 0.022
ovarian cancer 1.700 0.000

Synonym

Accession P84077 P10947 P32889
Symbols

Gene

PDB

4HMY   1HUR   1RE0   1U81   3O47  

 MGI Term (1)

Gene RIF (80)

PMID Text
26494761 this study reports the cryo-electron microscopy structures of the Nef- and Arf1-bound AP-1 trimer in the active and inactive states.
26330566 observations indicate that Arf1 and Arf3 as well as Arf6 play important roles in cytokinesis.
26169956 ARF1 activates the MAPK pathway likely using the Golgi as a main platform, which in turn activates the cytoplasmic RSK1, leading to cell proliferation.
25773595 Myristoylome profiling reveals a concerted mechanism of ARF GTPase deacylation by the Shigella protease IpaJ.
25754106 Data indicate that ADP-ribosylation factor 1 (Arf1) colocalizes with chromogranin A and regulates secretion of insulin like growth factor 1 (IGF-1) and is required for anchorage dependent growth.
25530216 ARF1 regulates cellularmigration of highly invasive triple-negative breast cancer cells, through the regulation of the focal adhesions complex.
25496667 Functional ARF1 is required for HIV-1 Nef-dependent endogenous HLA-A2 and CD4 downregulation in HIV-infected primary T cells
25114232 EFA6 is regulated by a negative feedback loop, which is mediated by an allosteric interaction of Arf6-GTP with a domain of EFA6 and monitors the activation of Arf1 and Arf6 differentially
24916416 Study adds to the expanding role for Arf1 in the periphery and identifies a requirement for Arf1, a "Golgi Arf," in the reorganization of the cortical actin cytoskeleton on ventral surfaces, against the substratum.
24911624 Class I ADP-ribosylation factors are involved in enterovirus 71 replication.
More...

AA Sequence

MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGG      1 - 70
QDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEIT     71 - 140
DKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK                                 141 - 181
//

Text Mined References (160)

PMID Year Title
26494761 2015 HIV-1 Nef hijacks clathrin coats by stabilizing AP-1:Arf1 polygons.
26330566 2016 Class I Arfs (Arf1 and Arf3) and Arf6 are localized to the Flemming body and play important roles in cytokinesis.
26169956 2015 The mechanism and function of mitogen-activated protein kinase activation by ARF1.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25807930 2015 Multifunctional reagents for quantitative proteome-wide analysis of protein modification in human cells and dynamic profiling of protein lipidation during vertebrate development.
25773595 2015 Myristoylome profiling reveals a concerted mechanism of ARF GTPase deacylation by the bacterial protease IpaJ.
25754106 2015 IGF-1 drives chromogranin A secretion via activation of Arf1 in human neuroendocrine tumour cells.
25530216 2015 ARF1 regulates adhesion of MDA-MB-231 invasive breast cancer cells through formation of focal adhesions.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25114232 2014 EFA6 controls Arf1 and Arf6 activation through a negative feedback loop.
More...