Property Summary

NCBI Gene PubMed Count 585
PubMed Score 1403.63
PubTator Score 687.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Thoracic aortic aneurysm 15 0.0 5.0

Expression

  Differential Expression (16)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 5.6e-04
atypical teratoid / rhabdoid tumor 1.200 1.2e-03
Chronic Lymphocytic Leukemia -1.107 6.7e-06
dermatomyositis -1.100 8.1e-04
glioblastoma 1.100 7.2e-03
group 3 medulloblastoma -1.100 1.1e-02
interstitial cystitis -1.100 1.6e-05
intraductal papillary-mucinous adenoma (... 1.200 9.2e-04
intraductal papillary-mucinous neoplasm ... 2.000 1.4e-03
malignant mesothelioma -1.500 8.1e-04
osteosarcoma 2.712 1.5e-07
ovarian cancer -1.300 1.0e-07
pancreatic ductal adenocarcinoma liver m... 2.035 1.0e-02
psoriasis -1.900 1.4e-04
tuberculosis -1.100 1.3e-03
Waldenstrons macroglobulinemia -1.077 1.4e-02

Protein-protein Interaction (8)

Gene RIF (435)

AA Sequence

MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRS      1 - 70
LDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLV     71 - 140
PRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPN    141 - 210
PMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRN    211 - 280
AAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAA    281 - 350
LLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR    351 - 420
CSSVS                                                                     421 - 425
//

Text Mined References (604)

PMID Year Title