Property Summary

NCBI Gene PubMed Count 519
Grant Count 701
R01 Count 458
Funding $48,550,267.51
PubMed Score 1043.21
PubTator Score 687.77

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Synonym

Accession P84022 A8K4B6 B7Z4Z5 B7Z6M9 B7Z9Q2 F5H383 O09064 O09144 O14510 O35273 Q92940 Q93002 Q9GKR4 MAD homolog 3
Symbols LDS3
LDS1C
MADH3
JV15-2
HSPC193
HsT17436

Gene

PANTHER Protein Class (1)

PDB

2LAJ   2LB2   1U7F   1MHD   1MJS   1MK2   1OZJ  

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
630 screening 255 / 0 / 87819 HTS of Smad transcription factor inhibitors
715 confirmatory 27 / 1 / 2 SMAD Transcription Factor Inhibitors Dose Response Confirmation
1058 confirmatory 1 / 0 / 36 SMAD Transcription Factor Inhibitors Secondary Dose Response Confirmation

Gene RIF (370)

PMID Text
26966064 These results for the first time demonstrate a role of Cdk5/p35 in the regulation of cell cycle progression modulated by TGF-beta1.
26680585 Data suggest SHC1 (SH2 domain protein C1) expression down-regulates epithelial-mesenchymal transition by repressing TGFB-induced SMAD2/3 activation through differential partitioning of receptors at cell surface of mammocytes/keratinocytes.
26669923 Our study demonstrates that SMAD3 is significantly overexpressed in osteoarthritis. This overexpression cannot be explained by DNA methylation in the promoter region.
26577380 these data demonstrate that the SMI drives ES cells to skeletal muscle via concerted activation of the Wnt pathway, and inhibition of Smad2/3 signaling and Shh pathways.
26497676 Induction of pSmad3L through BLT1-NOX-ROS-EGFR-PI3K-ERK1/2 signaling pathway is a key mechanism by which LTB4 blocks the anti-proliferative responses of TGF-beta1 in breast tumors.
26445225 TGF-beta/Smad signalling pathway and VEGF-A participate in the pathogenesis of sarcoidosis.
26417995 results demonstrated that the novel pathway H19/miR-675/TGF-beta1/Smad3/HDAC regulates osteogenic differentiation of hMSCs and may serve as a potential target for enhancing bone formation in vivo.
26403398 HoxB7 is associated with tumor metastasis in patients with lung adenocarcinoma and HoxB7 may be implicated in promoting the development of lung adenocarcinoma through activation of the TGF-beta/SMAD3 signaling.
26395178 Data show that the expression of transforming growth factor beta 1 (TGFB1) was correlated with the expression of SMA- and MAD-related protein 3 (SMAD3) and matrix metalloproteinase-13 (MMP13) in osteoarthritis (OA)-affected cartilage.
26384307 Up-regulation of smad3 is associated with endometrial cancer.
More...

AA Sequence

MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRS      1 - 70
LDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLV     71 - 140
PRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPN    141 - 210
PMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRN    211 - 280
AAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAA    281 - 350
LLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR    351 - 420
CSSVS                                                                     421 - 425
//

Text Mined References (538)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
27038547 2016 MiRNA-199a-5p influences pulmonary artery hypertension via downregulating Smad3.
26966064 2016 Transforming growth factor-?1 induces cell cycle arrest by activating atypical cyclin-dependent kinase 5 through up-regulation of Smad3-dependent p35 expression in human MCF10A mammary epithelial cells.
26680585 2015 ShcA Protects against Epithelial-Mesenchymal Transition through Compartmentalized Inhibition of TGF-?-Induced Smad Activation.
26669923 2016 SMAD3 Is Upregulated in Human Osteoarthritic Cartilage Independent of the Promoter DNA Methylation.
26577380 2016 Identification of Small Molecules Which Induce Skeletal Muscle Differentiation in Embryonic Stem Cells via Activation of the Wnt and Inhibition of Smad2/3 and Sonic Hedgehog Pathways.
26497676 2015 The proinflammatory LTB4/BLT1 signal axis confers resistance to TGF-?1-induced growth inhibition by targeting Smad3 linker region.
26445225 2015 Immunoexpression of TGF-?/Smad and VEGF-A proteins in serum and BAL fluid of sarcoidosis patients.
26417995 2015 Long Noncoding RNA H19 Promotes Osteoblast Differentiation Via TGF-?1/Smad3/HDAC Signaling Pathway by Deriving miR-675.
26403398 HoxB7 PROMOTES GROWTH AND METASTASIS OF LUNG ADENOCARCINOMA CELLS THROUGH REGULATION OF THE TGF-?/SMAD3 SIGNALING.
More...