Property Summary

NCBI Gene PubMed Count 67
PubMed Score 197.03
PubTator Score 104.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Prostatic Neoplasms 471
Disease Target Count P-value
non-small cell lung cancer 2798 5.83805408987828E-19
group 3 medulloblastoma 2254 3.91220411740572E-5
lung cancer 4473 1.30772163645848E-4
dermatomyositis 967 1.50230914587932E-4
ovarian cancer 8492 2.81986426538255E-4
Waldenstrons macroglobulinemia 765 0.0128307645664351
primary pancreatic ductal adenocarcinoma 1271 0.018032955948101
Disease Target Count Z-score Confidence
Warsaw breakage syndrome 12 3.317 1.7

Expression

  Differential Expression (7)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.035 0.013
group 3 medulloblastoma 1.700 0.000
primary pancreatic ductal adenocarcinoma 1.134 0.018
non-small cell lung cancer 1.094 0.000
lung cancer 1.300 0.000
ovarian cancer -1.600 0.000
dermatomyositis 1.400 0.000

Synonym

Accession P83916 P23197
Symbols CBX
M31
MOD1
p25beta
HP1-BETA
HP1Hsbeta
HP1Hs-beta

Gene

PDB

3Q6S   2FMM   3F2U   5T1G  

  Ortholog (11)

Species Source
Chimp OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
488953 confirmatory 186 / 277 / 817 qHTS Validation Assay for Inhibitors of HP1-beta Chromodomain Interactions with Methylated Histone Tails
488962 summary 0 / 0 / 0 Probe Summary Assay for Inhibitors of HP1-beta Chromodomain Interactions with Methylated Histone Tails
540317 confirmatory 2150 / 13416 / 371468 HTS for Inhibitors of HP1-beta Chromodomain Interactions with Methylated Histone Tails

Gene RIF (28)

PMID Text
27090491 Data show that heterochromatin protein 1-beta (HP1beta) is a prototypic HP1 protein exemplifying most basal chromatin binding and effects.
25769025 increased HP1beta expression is associated with the poor prognosis in breast cancer
24840329 Data suggest the reduction of Heterochromatin Protein 1 isoforms HP1beta followed by a decrease in HP1alpha contributes to the pathogenesis of thyroid carcinomas, and their loss is a potential marker of thyroid malignancy and metastatic potential, respectively.
24793759 In this review, we summarize the current knowledge about targeting and functional mechanisms of PRCs, emphasizing the recent breakthroughs related to CBX proteins under a number of physiological and pathological conditions.
24561199 Phosphorylation at Ser89 and Ser175 results in localized conformational changes in HP1beta that do not compromise the ability of the protein to bind chromatin.
23707759 The HP1beta interactome is enriched with Lys methylated proteins.Role of HP1beta in DNA damage response.
23585859 The structural plasticity of HP1beta supports its ability to bind and connect a wide variety of binding partners in epigenetic processes.
23536649 HP1 isoforms distinctly augment AR signaling and cell growth in prostate cancer. Therefore, silencing of HP1beta and HP1gamma may be a promising therapeutic strategy for treatment of prostate cancer.
23337132 HP1beta which is associated with PCNA in regions of DNA repair, is bound and does not exchange with the mobile pool, suggesting that HP1beta in association with PCNA may be a component of a DNA repair complex.
23287531 study finds that while HP1apha and beta stimulate homologous recombination and single-strand annealing, HP1gamma has an inhibitory role
More...

AA Sequence

MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQS      1 - 70
QKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKN     71 - 140
SDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN                             141 - 185
//

Text Mined References (76)

PMID Year Title
27090491 2016 Dynamic and flexible H3K9me3 bridging via HP1? dimerization establishes a plastic state of condensed chromatin.
25769025 2015 HP1? is a biomarker for breast cancer prognosis and PARP inhibitor therapy.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
24840329 2014 Heterochromatin protein 1 expression is reduced in human thyroid malignancy.
24793759 2014 Epigenetic regulation by polycomb group complexes: focus on roles of CBX proteins.
24561199 2014 Characterization of the effects of phosphorylation by CK2 on the structure and binding properties of human HP1?.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270157 2013 A quantitative telomeric chromatin isolation protocol identifies different telomeric states.
23707759 2013 A method for systematic mapping of protein lysine methylation identifies functions for HP1? in DNA damage response.
23585859 2013 Structural plasticity in human heterochromatin protein 1?.
More...