Property Summary

NCBI Gene PubMed Count 71
PubMed Score 203.08
PubTator Score 104.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
dermatomyositis 1.400 1.5e-04
group 3 medulloblastoma 1.700 3.9e-05
lung cancer 1.300 1.3e-04
non-small cell lung cancer 1.094 5.8e-19
ovarian cancer -1.600 2.8e-04
primary pancreatic ductal adenocarcinoma 1.134 1.8e-02
Waldenstrons macroglobulinemia 1.035 1.3e-02

Gene RIF (29)

AA Sequence

MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQS      1 - 70
QKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKN     71 - 140
SDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN                             141 - 185
//

Text Mined References (81)

PMID Year Title