Property Summary

NCBI Gene PubMed Count 22
Grant Count 29
R01 Count 14
Funding $2,360,038.12
PubMed Score 6.93
PubTator Score 6.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Pure red-cell aplasia 4 4.043 2.0

Expression

Gene RIF (2)

PMID Text
26362536 HIV-1 Gag interacts with RPL36A as demonstrated by proximity dependent biotinylation proteomics
14752831 RPL36A plays a role in tumor cell proliferation and may be a potential target for anticancer therapy of hepatocellular carcinoma

AA Sequence

MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGKRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRL      1 - 70
ECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF                                       71 - 106
//

Text Mined References (23)

PMID Year Title
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
20967262 2010 Expression of conjoined genes: another mechanism for gene regulation in eukaryotes.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15189156 2004 The molecular mechanics of eukaryotic translation.
14752831 2004 Over-expression of the ribosomal protein L36a gene is associated with cellular proliferation in hepatocellular carcinoma.
More...