Property Summary

NCBI Gene PubMed Count 22
PubMed Score 6.93
PubTator Score 6.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
Pure red-cell aplasia 4 4.043 2.0

Expression

Synonym

Accession P83881 P09896 P10661 Q08ES5 Q5J9I6
Symbols L36A
L44L
MIG6
RPL44

Gene

PDB

4UG0   4V6X   5AJ0  

  Ortholog (4)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid

Gene RIF (2)

PMID Text
26362536 HIV-1 Gag interacts with RPL36A as demonstrated by proximity dependent biotinylation proteomics
14752831 RPL36A plays a role in tumor cell proliferation and may be a potential target for anticancer therapy of hepatocellular carcinoma

AA Sequence

MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGKRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRL      1 - 70
ECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF                                       71 - 106
//

Text Mined References (23)

PMID Year Title
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
20967262 2010 Expression of conjoined genes: another mechanism for gene regulation in eukaryotes.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15189156 2004 The molecular mechanics of eukaryotic translation.
14752831 2004 Over-expression of the ribosomal protein L36a gene is associated with cellular proliferation in hepatocellular carcinoma.
More...