Property Summary

NCBI Gene PubMed Count 22
PubMed Score 7.45
PubTator Score 6.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Adenocarcinoma of lung 142 0.0 0.0
Disease Models, Animal 155 0.0 0.0
Disease Target Count Z-score Confidence
Pure red-cell aplasia 4 4.071 2.0

Expression

Protein-protein Interaction (2)

Gene RIF (2)

AA Sequence

MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGKRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRL      1 - 70
ECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF                                       71 - 106
//

Text Mined References (24)

PMID Year Title