Property Summary

NCBI Gene PubMed Count 22
PubMed Score 7.45
PubTator Score 6.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Adenocarcinoma of lung 142 0.0 0.0
Disease Models, Animal 155 0.0 0.0
Disease Target Count Z-score Confidence
Pure red-cell aplasia 4 4.071 2.0

Expression

Synonym

Accession P83881 P09896 P10661 Q08ES5 Q5J9I6
Symbols L36A
L44L
MIG6
RPL44

Gene

PDB

4UG0   4V6X   5AJ0   5LKS   5T2C  

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Protein-protein Interaction (2)

Gene RIF (2)

AA Sequence

MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGKRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRL      1 - 70
ECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF                                       71 - 106
//

Text Mined References (24)

PMID Year Title