Property Summary

NCBI Gene PubMed Count 17
PubMed Score 10.05
PubTator Score 25.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Multiple myeloma 1.227 5.7e-04
astrocytic glioma -1.900 5.4e-03
ependymoma -1.800 1.9e-02
psoriasis 1.600 1.3e-04
osteosarcoma -1.662 1.4e-03
atypical teratoid / rhabdoid tumor -1.600 9.2e-04
glioblastoma -1.600 1.8e-03
lung cancer 2.600 6.7e-05
diabetes mellitus -1.100 1.5e-03
adult high grade glioma -1.600 7.4e-04
ovarian cancer 2.600 9.8e-06

Gene RIF (3)

PMID Text
25434003 Reporter gene and in vivo assays showed that the promoter deletions led to reduced expression of TXNL4A. Depletion of TXNL4A (Dib1) in yeast demonstrated reduced assembly of the tri-snRNP complex.
20307692 frameshift mutations in the PQBP-1 gene lead to expression of mutants lacking the ability to interact with U5-15kD
17177886 human dim1 is a peptidase with autocleavage activity that results in a thioredoxin-like core

AA Sequence

MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFN      1 - 70
KMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKY     71 - 140
RY                                                                        141 - 142
//

Text Mined References (22)

PMID Year Title
25434003 2014 Compound heterozygosity of low-frequency promoter deletions and rare loss-of-function mutations in TXNL4A causes Burn-McKeown syndrome.
25416956 2014 A proteome-scale map of the human interactome network.
24781215 2014 Mutations in the PQBP1 gene prevent its interaction with the spliceosomal protein U5-15 kD.
21269460 2011 Initial characterization of the human central proteome.
20858735 2010 Interactions of ErbB4 and Kap1 connect the growth factor and DNA damage response pathways.
20307692 2010 Polyglutamine tract-binding protein-1 binds to U5-15kD via a continuous 23-residue segment of the C-terminal domain.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18559850 2008 Minor spliceosome components are predominantly localized in the nucleus.
17467737 2007 Structural basis for the bifunctionality of the U5 snRNP 52K protein (CD2BP2).
17177886 2006 Identification of human dim1 as a peptidase with autocleavage activity.
16723661 2006 The network of protein-protein interactions within the human U4/U6.U5 tri-snRNP.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15840814 2005 The human U5 snRNP 52K protein (CD2BP2) interacts with U5-102K (hPrp6), a U4/U6.U5 tri-snRNP bridging protein, but dissociates upon tri-snRNP formation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12911302 2003 Structure, stability, and function of hDim1 investigated by NMR, circular dichroism, and mutational analysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
11054566 2000 Evidence that dim1 associates with proteins involved in pre-mRNA splicing, and delineation of residues essential for dim1 interactions with hnRNP F and Npw38/PQBP-1.
11015569 1999 The evolutionarily conserved Dim1 protein defines a novel branch of the thioredoxin fold superfamily.
10610776 1999 Identification, characterization and crystal structure analysis of the human spliceosomal U5 snRNP-specific 15 kD protein.