Property Summary

NCBI Gene PubMed Count 19
PubMed Score 51.61
PubTator Score 26.45

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
25858563 we show a moderate positive correlation between plasma 26RFa levels and insulin in patients with diabetes. Plasma 26RFa increases in response to glucose tolerance test. 26RFa and its receptor GPR103 are present in human pancreatic beta-cells and gut.
22863147 Data indicate that 26RFa may participate to the development of prostate cancer at the androgen independent state by promoting the neuroendocrine differentiation and the migration of cancer cells via autocrine/paracrine mechanisms.
22466335 High levels of circulating 26RFa observed in anorexia nervosa patients might reflect an adaptive mechanism of the organism to promote energy intake and to increase fat stores in response to undernutrition.
20534693 Results suggest that GPR103b and QRFP work in an autocrine/paracrine manner to regulate adipogenesis.
16899066 Characterization of 26RFa-related peptides showed that two distinct molecular forms of 26RFa are present in the human hypothalamus and spinal cord, i.e. 26RFa and an N-terminally elongated form of 43 amino acids designated 43RFa.
15891009 A bioinformatic search for peptides related to frog 26RFa reveals the presence of homologous sequences in the human genome.
15808908 Solution conformation of 26RFa by using two-dimensional NMR spectroscopy in different media was investigated.
12714592 P518 exhibited high affinity for SP9155. The peptide P518 precursor gene is predominantly expressed in various brain regions, coronary arteries, thyroid and parathyroid glands, large intestine, colon, bladder, testes, and prostate.

AA Sequence

MVRPYPLIYFLFLPLGACFPLLDRREPTDAMGGLGAGERWADLAMGPRPHSVWGSSRWLRASQPQALLVI      1 - 70
ARGLQTSGREHAGCRFRFGRQDEGSEATGFLPAAGEKTSGPLGNLAEELNGYSRKKGGFSFRFGRR         71 - 136
//

Text Mined References (20)

PMID Year Title
25858563 2015 Hypothalamic Neuropeptide 26RFa Acts as an Incretin to Regulate Glucose Homeostasis.
23979792 2013 Hypothalamic QRFP: regulation of food intake and fat selection.
23964068 2013 QRFP induces aldosterone production via PKC and T-type calcium channel-mediated pathways in human adrenocortical cells: evidence for a novel role of GPR103.
23396314 2013 Screening ?-arrestin recruitment for the identification of natural ligands for orphan G-protein-coupled receptors.
22863147 2013 The neuropeptide 26RFa is expressed in human prostate cancer and stimulates the neuroendocrine differentiation and the migration of androgeno-independent prostate cancer cells.
22466335 2012 Orexigenic neuropeptide 26RFa: new evidence for an adaptive profile of appetite regulation in anorexia nervosa.
21530572 2011 The RFamide neuropeptide 26RFa and its role in the control of neuroendocrine functions.
20534693 2010 GPR103b functions in the peripheral regulation of adipogenesis.
16899066 2006 Anatomical distribution and biochemical characterization of the novel RFamide peptide 26RFa in the human hypothalamus and spinal cord.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
More...