Property Summary

NCBI Gene PubMed Count 19
PubMed Score 54.93
PubTator Score 26.45

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

AA Sequence

MVRPYPLIYFLFLPLGACFPLLDRREPTDAMGGLGAGERWADLAMGPRPHSVWGSSRWLRASQPQALLVI      1 - 70
ARGLQTSGREHAGCRFRFGRQDEGSEATGFLPAAGEKTSGPLGNLAEELNGYSRKKGGFSFRFGRR         71 - 136
//

Text Mined References (20)

PMID Year Title