Property Summary

NCBI Gene PubMed Count 25
PubMed Score 363.53
PubTator Score 11.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
diabetes mellitus 1663 0.00130398373926687
non diabetic and post-ischemic heart failure 200 0.0196041172756673
Disease Target Count Z-score Confidence
Osteoporosis 259 5.789 2.9
Spondylosis 13 3.75 1.9
Amenorrhea 60 3.018 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
non diabetic and post-ischemic heart fai... -1.100 0.020
diabetes mellitus -1.600 0.001

Synonym

Accession P83731 B2R4Y3 P38663 Q6IBS3
Symbols L24
HEL-S-310

Gene

PDB

4UG0   4V6X   5AJ0   5A2Q  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
25520117 Ribosomal protein L24 overexpression in hepatocellular carcinoma.
24970821 Data suggest that ribosomal subunit protein 24 (RPL24) lysine K27 acetylation may play a role in ribosome assembly.
23125841 Tandem affinity purification and mass spectrometry analysis identify ribosomal protein L24 (RPL24), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells

AA Sequence

MKVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHKKGQSEEIQKK      1 - 70
RTRRAVKFQRAITGASLADIMAKRNQKPEVRKAQREQAIRAAKEAKKAKQASKKTAMAAAKAPTKAAPKQ     71 - 140
KIVKPVKVSAPRVGGKR                                                         141 - 157
//

Text Mined References (34)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25520117 2014 Drug resistance effects of ribosomal protein L24 overexpression in hepatocellular carcinoma HepG2 cells.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24970821 2014 RPL24: a potential therapeutic target whose depletion or acetylation inhibits polysome assembly and cancer cell growth.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
More...