Property Summary

NCBI Gene PubMed Count 25
Grant Count 13
R01 Count 8
Funding $1,175,731.27
PubMed Score 363.53
PubTator Score 11.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
non diabetic and post-ischemic heart fai... -1.100 0.020
diabetes mellitus -1.600 0.001

Gene RIF (6)

PMID Text
25520117 Ribosomal protein L24 overexpression in hepatocellular carcinoma.
24970821 Data suggest that ribosomal subunit protein 24 (RPL24) lysine K27 acetylation may play a role in ribosome assembly.
23125841 Tandem affinity purification and mass spectrometry analysis identify ribosomal protein L24 (RPL24), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify ribosomal protein L24 (RPL24), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify ribosomal protein L24 (RPL24), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify ribosomal protein L24 (RPL24), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells

AA Sequence

MKVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHKKGQSEEIQKK      1 - 70
RTRRAVKFQRAITGASLADIMAKRNQKPEVRKAQREQAIRAAKEAKKAKQASKKTAMAAAKAPTKAAPKQ     71 - 140
KIVKPVKVSAPRVGGKR                                                         141 - 157
//

Text Mined References (34)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25520117 2014 Drug resistance effects of ribosomal protein L24 overexpression in hepatocellular carcinoma HepG2 cells.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24970821 2014 RPL24: a potential therapeutic target whose depletion or acetylation inhibits polysome assembly and cancer cell growth.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
More...