Property Summary

NCBI Gene PubMed Count 25
PubMed Score 366.88
PubTator Score 11.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Gastrointestinal Stromal Tumors 48 0.0 0.0
Disease Target Count P-value
diabetes mellitus 1728 1.3e-03
non diabetic and post-ischemic heart failure 200 2.0e-02
Disease Target Count Z-score Confidence
Osteoporosis 363 5.784 2.9
Spondylosis 16 4.083 2.0
Amenorrhea 58 3.032 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.600 1.3e-03
non diabetic and post-ischemic heart fai... -1.100 2.0e-02

Gene RIF (3)

AA Sequence

MKVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHKKGQSEEIQKK      1 - 70
RTRRAVKFQRAITGASLADIMAKRNQKPEVRKAQREQAIRAAKEAKKAKQASKKTAMAAAKAPTKAAPKQ     71 - 140
KIVKPVKVSAPRVGGKR                                                         141 - 157
//

Text Mined References (36)

PMID Year Title